Human TNFRSF12A/CD266/FN14 ORF/cDNA clone-Lentivirus plasmid (NM_016639.3)

Cat. No.: pGMLV002476
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TNFRSF12A/CD266/FN14 Lentiviral expression plasmid for TNFRSF12A lentivirus packaging, TNFRSF12A lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to TWEAKR/CD266/TNFRSF12A/TNFRSF12A/CD266 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV002476
Gene Name TNFRSF12A
Accession Number NM_016639.3
Gene ID 51330
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 390 bp
Gene Alias CD266,FN14,TWEAKR
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCGGGGCTCGCTGCGCCGGTTGCTGCGGCTCCTCGTGCTGGGGCTCTGGCTGGCGTTGCTGCGCTCCGTGGCCGGGGAGCAAGCGCCAGGCACCGCCCCCTGCTCCCGCGGCAGCTCCTGGAGCGCGGACCTGGACAAGTGCATGGACTGCGCGTCTTGCAGGGCGCGACCGCACAGCGACTTCTGCCTGGGCTGCGCTGCAGCACCTCCTGCCCCCTTCCGGCTGCTTTGGCCCATCCTTGGGGGCGCTCTGAGCCTGACCTTCGTGCTGGGGCTGCTTTCTGGCTTTTTGGTCTGGAGACGATGCCGCAGGAGAGAGAAGTTCACCACCCCCATAGAGGAGACCGGCGGAGAGGGCTGCCCAGCTGTGGCGCTGATCCAGTGA
ORF Protein Sequence MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-180 Pre-Made Enavatuzumab biosimilar, Whole mAb, Anti-TNFRSF12A Antibody: Anti-CD2664/TWEAKR therapeutic antibody
    Target Antibody GM-Tg-g-T28717-Ab Anti-TNR12/ TNFRSF12A/ CD266 monoclonal antibody
    Target Antigen GM-Tg-g-T28717-Ag TNFRSF12A VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-T28717 Tumor necrosis factor receptor superfamily, member 12A (TNFRSF12A) protein & antibody
    ORF Viral Vector pGMLP000633 Human TNFRSF12A Lentivirus plasmid
    ORF Viral Vector pGMLV001138 Human TNFRSF12A Lentivirus plasmid
    ORF Viral Vector pGMLV002476 Human TNFRSF12A Lentivirus plasmid
    ORF Viral Vector pGMAD001671 Human TNFRSF12A Adenovirus plasmid
    ORF Viral Vector vGMLP000633 Human TNFRSF12A Lentivirus particle
    ORF Viral Vector vGMLV001138 Human TNFRSF12A Lentivirus particle
    ORF Viral Vector vGMLV002476 Human TNFRSF12A Lentivirus particle
    ORF Viral Vector vGMAD001671 Human TNFRSF12A Adenovirus particle


    Target information

    Target ID GM-T28717
    Target Name TWEAKR/CD266/TNFRSF12A
    Gene Group Identifier
    (Target Gene ID in Homo species)
    51330
    Gene ID 100146755 (Equus caballus), 101098186 (Felis catus), 27279 (Mus musculus), 302965 (Rattus norvegicus)
    51330 (Homo sapiens), 610734 (Canis lupus familiaris), 617439 (Bos taurus), 699970 (Macaca mulatta)
    Gene Symbols & Synonyms TNFRSF12A,Tnfrsf12a,Fn14,HPIP,TweakR,TWEAK-R,FN14,CD266,TWEAKR
    Target Alternative Names CD266,FN14,Fibroblast growth factor-inducible immediate-early response protein 14 (FGF-inducible 14),Fn14,HPIP,TNFRSF12A,TWEAK-R,TWEAKR,Tnfrsf12a,Tumor necrosis factor receptor superfamily member 12A,Tweak-receptor (TweakR),TweakR
    Uniprot Accession Q9CR75,Q9NP84
    Additional SwissProt Accessions: Q9CR75,Q9NP84
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction
    Gene Ensembl ENSMUSG00000023905, ENSG00000006327, ENSBTAG00000012082
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.