Human LGALS3/CBP35/GAL3 ORF/cDNA clone-Lentivirus plasmid (NM_002306.4)
Cat. No.: pGMLV002276
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human LGALS3/CBP35/GAL3 Lentiviral expression plasmid for LGALS3 lentivirus packaging, LGALS3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
Galectin-3/Galectin 3/LGALS3/LGALS3/CBP35 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV002276 |
| Gene Name | LGALS3 |
| Accession Number | NM_002306.4 |
| Gene ID | 3958 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 753 bp |
| Gene Alias | CBP35,GAL3,GALBP,GALIG,L31,LGALS2,MAC2 |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCAGACAATTTTTCGCTCCATGATGCGTTATCTGGGTCTGGAAACCCAAACCCTCAAGGATGGCCTGGCGCATGGGGGAACCAGCCTGCTGGGGCAGGGGGCTACCCAGGGGCTTCCTATCCTGGGGCCTACCCCGGGCAGGCACCCCCAGGGGCTTATCCTGGACAGGCACCTCCAGGCGCCTACCCTGGAGCACCTGGAGCTTATCCCGGAGCACCTGCACCTGGAGTCTACCCAGGGCCACCCAGCGGCCCTGGGGCCTACCCATCTTCTGGACAGCCAAGTGCCACCGGAGCCTACCCTGCCACTGGCCCCTATGGCGCCCCTGCTGGGCCACTGATTGTGCCTTATAACCTGCCTTTGCCTGGGGGAGTGGTGCCTCGCATGCTGATAACAATTCTGGGCACGGTGAAGCCCAATGCAAACAGAATTGCTTTAGATTTCCAAAGAGGGAATGATGTTGCCTTCCACTTTAACCCACGCTTCAATGAGAACAACAGGAGAGTCATTGTTTGCAATACAAAGCTGGATAATAACTGGGGAAGGGAAGAAAGACAGTCGGTTTTCCCATTTGAAAGTGGGAAACCATTCAAAATACAAGTACTGGTTGAACCTGACCACTTCAAGGTTGCAGTGAATGATGCTCACTTGTTGCAGTACAATCATCGGGTTAAAAAACTCAATGAAATCAGCAAACTGGGAATTTCTGGTGACATAGACCTCACCAGTGCTTCATATACCATGATATAA |
| ORF Protein Sequence | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T72038-Ab | Anti-LEG3/ LGALS3/ CBP35 monoclonal antibody |
| Target Antigen | GM-Tg-g-T72038-Ag | LGALS3 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000501 | Human LGALS3 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001314 | Human LGALS3 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002196 | Human LGALS3 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002276 | Human LGALS3 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000432 | Human LGALS3 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000875 | Human LGALS3 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC001102 | Human LGALS3 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP000501 | Human LGALS3 Lentivirus particle |
| ORF Viral Vector | vGMLV001314 | Human LGALS3 Lentivirus particle |
| ORF Viral Vector | vGMLV002196 | Human LGALS3 Lentivirus particle |
| ORF Viral Vector | vGMLV002276 | Human LGALS3 Lentivirus particle |
| ORF Viral Vector | vGMAP000432 | Human LGALS3 Adenovirus particle |
Target information
| Target ID | GM-T72038 |
| Target Name | Galectin-3/Galectin 3/LGALS3 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
3958 |
| Gene ID |
100050367 (Equus caballus), 101081472 (Felis catus), 16854 (Mus musculus), 3958 (Homo sapiens) 404021 (Canis lupus familiaris), 697290 (Macaca mulatta), 786492 (Bos taurus), 83781 (Rattus norvegicus) |
| Gene Symbols & Synonyms | LGALS3,Lgals3,galectin-3,GBP,L-34,gal3,Mac-2,L31,GAL3,MAC2,CBP35,GALBP,GALIG,LGALS2,Gal-3,CBP 35,Galectin-3,CBP30,gal-3,AGE-R3 |
| Target Alternative Names | 35 kDa lectin,AGE-R3,CBP 35,CBP30,CBP35,Carbohydrate-binding protein 35 (CBP 35),GAL3,GALBP,GALIG,GBP,Gal-3,Galactose-specific lectin 3,Galactoside-binding protein (GALBP),Galectin 3,Galectin-3,IgE-binding protein,L-31,L-34,L31,LGALS2,LGALS3,Laminin-binding protein,Lectin L-29,Lgals3,MAC2,Mac-2,Mac-2 antigen,gal-3,gal3,galectin-3 |
| Uniprot Accession |
P08699,P16110,P17931,P38486
Additional SwissProt Accessions: P16110,P17931,P38486,P08699 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Immuno-oncology Target |
| Disease | cancer |
| Disease from KEGG | |
| Gene Ensembl | ENSECAG00000006474, ENSMUSG00000050335, ENSG00000131981, ENSCAFG00845015017, ENSMMUG00000003565, ENSBTAG00000002326 |
| Target Classification | Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA) |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


