Human NPPA/ANF/ANP ORF/cDNA clone-Lentivirus plasmid (NM_006172.4)
Cat. No.: pGMLV002264
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human NPPA/ANF/ANP Lentiviral expression plasmid for NPPA lentivirus packaging, NPPA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
NPPA/ANF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV002264 |
Gene Name | NPPA |
Accession Number | NM_006172.4 |
Gene ID | 4878 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 456 bp |
Gene Alias | ANF,ANP,ATFB6,ATRST2,CDD,CDD-ANF,CDP,PND |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGCTCCTTCTCCACCACCACCGTGAGCTTCCTCCTTTTACTGGCATTCCAGCTCCTAGGTCAGACCAGAGCTAATCCCATGTACAATGCCGTGTCCAACGCAGACCTGATGGATTTCAAGAATTTGCTGGACCATTTGGAAGAAAAGATGCCTTTAGAAGATGAGGTCGTGCCCCCACAAGTGCTCAGTGAGCCGAATGAAGAAGCGGGGGCTGCTCTCAGCCCCCTCCCTGAGGTGCCTCCCTGGACCGGGGAAGTCAGCCCAGCCCAGAGAGATGGAGGTGCCCTCGGGCGGGGCCCCTGGGACTCCTCTGATCGATCTGCCCTCCTAAAAAGCAAGCTGAGGGCGCTGCTCACTGCCCCTCGGAGCCTGCGGAGATCCAGCTGCTTCGGGGGCAGGATGGACAGGATTGGAGCCCAGAGCGGACTGGGCTGTAACAGCTTCCGGTACTGA |
ORF Protein Sequence | MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0373-Ab | Anti-ANF/ NPPA/ ANP functional antibody |
Target Antigen | GM-Tg-g-SE0373-Ag | NPPA protein |
ORF Viral Vector | pGMLP000970 | Human NPPA Lentivirus plasmid |
ORF Viral Vector | pGMLV002264 | Human NPPA Lentivirus plasmid |
ORF Viral Vector | vGMLP000970 | Human NPPA Lentivirus particle |
ORF Viral Vector | vGMLV002264 | Human NPPA Lentivirus particle |
Target information
Target ID | GM-SE0373 |
Target Name | NPPA |
Gene Group Identifier (Target Gene ID in Homo species) |
4878 |
Gene ID |
100034201 (Equus caballus), 101100575 (Felis catus), 230899 (Mus musculus), 24602 (Rattus norvegicus) 281355 (Bos taurus), 4878 (Homo sapiens), 608289 (Canis lupus familiaris), 714994 (Macaca mulatta) |
Gene Symbols & Synonyms | NPPA,Nppa,CDD,proANF,proANP,preproANF,preproANP,ANP,Anf,Pnd,ANF,RATANF,CDP,PND,ATFB6,ATRST2,CDD-ANF |
Target Alternative Names | NPPA,Natriuretic peptides A,Atrial natriuretic factor prohormone (proANF), Atrial natriuretic peptide prohormone (preproANP, proANP), Atriopeptigen, Cardiodilatin (CDD), preproCDD-ANF,ANF,ANP,CDD,CDP,PND,ATFB6,ATRST2,CDD-ANF |
Uniprot Accession |
P01160,P01161,P05125,P07499,P07501,P27104,Q9GLD0
Additional SwissProt Accessions: P27104,Q9GLD0,P05125,P01161,P07501,P01160,P07499 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Diagnostics Biomarker |
Disease | |
Disease from KEGG | cGMP-PKG signaling pathway, cAMP signaling pathway, HIF-1 signaling pathway, Vascular smooth muscle contraction, Oxytocin signaling pathway, Regulation of lipolysis in adipocytes, Renin secretion, Aldosterone synthesis and secretion, African trypanosomiasis |
Gene Ensembl | ENSECAG00000014892, ENSMUSG00000041616, ENSBTAG00000006709, ENSG00000175206, ENSCAFG00845001994, ENSMMUG00000007834 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.