Human FGF21 ORF/cDNA clone-Lentivirus plasmid (NM_019113)

Cat. No.: pGMLV002194
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FGF21/ Lentiviral expression plasmid for FGF21 lentivirus packaging, FGF21 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to FGF-21/FGF21/FGF21 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $457.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV002194
Gene Name FGF21
Accession Number NM_019113
Gene ID 26291
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 630 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACTCGGACGAGACCGGGTTCGAGCACTCAGGACTGTGGGTTTCTGTGCTGGCTGGTCTTCTGCTGGGAGCCTGCCAGGCACACCCCATCCCTGACTCCAGTCCTCTCCTGCAATTCGGGGGCCAAGTCCGGCAGCGGTACCTCTACACAGATGATGCCCAGCAGACAGAAGCCCACCTGGAGATCAGGGAGGATGGGACGGTGGGGGGCGCTGCTGACCAGAGCCCCGAAAGTCTCCTGCAGCTGAAAGCCTTGAAGCCGGGAGTTATTCAAATCTTGGGAGTCAAGACATCCAGGTTCCTGTGCCAGCGGCCAGATGGGGCCCTGTATGGATCGCTCCACTTTGACCCTGAGGCCTGCAGCTTCCGGGAGCTGCTTCTTGAGGACGGATACAATGTTTACCAGTCCGAAGCCCACGGCCTCCCGCTGCACCTGCCAGGGAACAAGTCCCCACACCGGGACCCTGCACCCCGAGGACCAGCTCGCTTCCTGCCACTACCAGGCCTGCCCCCCGCACTCCCGGAGCCACCCGGAATCCTGGCCCCCCAGCCCCCCGATGTGGGCTCCTCGGACCCTCTGAGCATGGTGGGACCTTCCCAGGGCCGAAGCCCCAGCTACGCTTCCTGA
ORF Protein Sequence MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T42928-Ab Anti-FGF21 functional antibody
    Target Antigen GM-Tg-g-T42928-Ag FGF21 protein
    Cytokine cks-Tg-g-GM-T42928 fibroblast growth factor 21 (FGF21) protein & antibody
    ORF Viral Vector pGMLP003451 Human FGF21 Lentivirus plasmid
    ORF Viral Vector pGMLV001311 Human FGF21 Lentivirus plasmid
    ORF Viral Vector pGMLV002194 Human FGF21 Lentivirus plasmid
    ORF Viral Vector pGMAAV000245 Human FGF21 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP003451 Human FGF21 Lentivirus particle
    ORF Viral Vector vGMLV001311 Human FGF21 Lentivirus particle
    ORF Viral Vector vGMLV002194 Human FGF21 Lentivirus particle
    ORF Viral Vector vGMAAV000245 Human FGF21 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T42928
    Target Name FGF-21/FGF21
    Gene Group Identifier
    （Target Gene ID in Homo species)         		26291
    Gene ID 100054542 (Equus caballus), 101080595 (Felis catus), 170580 (Rattus norvegicus), 26291 (Homo sapiens)
    484395 (Canis lupus familiaris), 56636 (Mus musculus), 718288 (Macaca mulatta), 785576 (Bos taurus)
    Gene Symbols & Synonyms FGF21,Fgf21,FGF8C,Fgf8c
    Target Alternative Names FGF-21,FGF21,FGF8C,Fgf21,Fgf8c,Fibroblast growth factor 21
    Uniprot Accession Q9JJN1,Q9NSA1
    Additional SwissProt Accessions: Q9NSA1,Q9JJN1
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Melanoma, Breast cancer, Gastric cancer
    Gene Ensembl ENSECAG00000010695, ENSG00000105550, ENSCAFG00845000788, ENSMUSG00000030827, ENSMMUG00000028737, ENSBTAG00000011624
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.