Human ADIPOQ/ACDC/ACRP30 ORF/cDNA clone-Lentivirus plasmid (NM_004797.4)

Cat. No.: pGMLV002165
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ADIPOQ/ACDC/ACRP30 Lentiviral expression plasmid for ADIPOQ lentivirus packaging, ADIPOQ lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to Adiponectin/ADIPOQ/ADIPOQ/ACDC products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $483.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV002165
Gene Name ADIPOQ
Accession Number NM_004797.4
Gene ID 9370
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 735 bp
Gene Alias ACDC,ACRP30,ADIPQTL1,ADPN,APM-1,APM1,GBP28
Fluorescent Reporter mCherry
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGTTGCTGGGAGCTGTTCTACTGCTATTAGCTCTGCCCGGTCATGACCAGGAAACCACGACTCAAGGGCCCGGAGTCCTGCTTCCCCTGCCCAAGGGGGCCTGCACAGGTTGGATGGCGGGCATCCCAGGGCATCCGGGCCATAATGGGGCCCCAGGCCGTGATGGCAGAGATGGCACCCCTGGTGAGAAGGGTGAGAAAGGAGATCCAGGTCTTATTGGTCCTAAGGGAGACATCGGTGAAACCGGAGTACCCGGGGCTGAAGGTCCCCGAGGCTTTCCGGGAATCCAAGGCAGGAAAGGAGAACCTGGAGAAGGTGCCTATGTATACCGCTCAGCATTCAGTGTGGGATTGGAGACTTACGTTACTATCCCCAACATGCCCATTCGCTTTACCAAGATCTTCTACAATCAGCAAAACCACTATGATGGCTCCACTGGTAAATTCCACTGCAACATTCCTGGGCTGTACTACTTTGCCTACCACATCACAGTCTATATGAAGGATGTGAAGGTCAGCCTCTTCAAGAAGGACAAGGCTATGCTCTTCACCTATGATCAGTACCAGGAAAATAATGTGGACCAGGCCTCCGGCTCTGTGCTCCTGCATCTGGAGGTGGGCGACCAAGTCTGGCTCCAGGTGTATGGGGAAGGAGAGCGTAATGGACTCTATGCTGATAATGACAATGACTCCACCTTCACAGGCTTTCTTCTCTACCATGACACCAACTGA
ORF Protein Sequence MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T15572-Ab Anti-ADIPO/ ADIPOQ/ ACDC functional antibody
    Target Antigen GM-Tg-g-T15572-Ag ADIPOQ protein
    ORF Viral Vector pGMLV002165 Human ADIPOQ Lentivirus plasmid
    ORF Viral Vector pGMAP000564 Human ADIPOQ Adenovirus plasmid
    ORF Viral Vector vGMLV002165 Human ADIPOQ Lentivirus particle
    ORF Viral Vector vGMAP000564 Human ADIPOQ Adenovirus particle


    Target information

    Target ID GM-T15572
    Target Name Adiponectin/ADIPOQ
    Gene Group Identifier
    （Target Gene ID in Homo species)         		9370
    Gene ID 100059500 (Equus caballus), 11450 (Mus musculus), 246253 (Rattus norvegicus), 282865 (Bos taurus)
    403625 (Canis lupus familiaris), 554338 (Felis catus), 574212 (Macaca mulatta), 9370 (Homo sapiens)
    Gene Symbols & Synonyms ADIPOQ,Adipoq,ADID,Ad,APN,Acdc,Adid,apM1,30kDa,GBP28,adipo,Acrp30,APM1,ACRP30,ACDC,ADPN,APM-1,ADIPQTL1
    Target Alternative Names 30 kDa adipocyte complement-related protein,30kDa,ACDC,ACRP30,ADID,ADIPOQ,ADIPQTL1,ADPN,APM-1,APM1,APN,Acdc,Acrp30,Ad,Adid,Adipocyte,Adipocyte complement-related 30 kDa protein (ACRP30),Adiponectin,Adipoq,Adipose most abundant gene transcript 1 protein (apM-1),C1q and collagen domain-containing protein,GBP28,Gelatin-binding protein,adipo,apM1
    Uniprot Accession Q15848,Q3Y5Z3,Q60994
    Additional SwissProt Accessions: Q60994,Q3Y5Z3,Q15848
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Diagnostics Biomarker
    Disease cancer, Breast Cancer
    Disease from KEGG PPAR signaling pathway, Longevity regulating pathway, Adipocytokine signaling pathway, Type II diabetes mellitus, Alcoholic liver disease
    Gene Ensembl ENSECAG00000002962, ENSMUSG00000022878, ENSBTAG00000059085, ENSCAFG00845021949, ENSMMUG00000002684, ENSG00000181092
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.