Human SERPINA1/A1A/A1AT ORF/cDNA clone-Lentivirus plasmid (NM_000295.5)
Cat. No.: pGMLV002164
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SERPINA1/A1A/A1AT Lentiviral expression plasmid for SERPINA1 lentivirus packaging, SERPINA1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
Alpha 1 Antitrypsin/Alpha-1-antitrypsin/SERPINA1/SERPINA1/A1A products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV002164 |
| Gene Name | SERPINA1 |
| Accession Number | NM_000295.5 |
| Gene ID | 5265 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 1257 bp |
| Gene Alias | A1A,A1AT,AAT,alpha1AT,nNIF,PI,PI1,PRO2275 |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCCGTCTTCTGTCTCGTGGGGCATCCTCCTGCTGGCAGGCCTGTGCTGCCTGGTCCCTGTCTCCCTGGCTGAGGATCCCCAGGGAGATGCTGCCCAGAAGACAGATACATCCCACCATGATCAGGATCACCCAACCTTCAACAAGATCACCCCCAACCTGGCTGAGTTCGCCTTCAGCCTATACCGCCAGCTGGCACACCAGTCCAACAGCACCAATATCTTCTTCTCCCCAGTGAGCATCGCTACAGCCTTTGCAATGCTCTCCCTGGGGACCAAGGCTGACACTCACGATGAAATCCTGGAGGGCCTGAATTTCAACCTCACGGAGATTCCGGAGGCTCAGATCCATGAAGGCTTCCAGGAACTCCTCCGTACCCTCAACCAGCCAGACAGCCAGCTCCAGCTGACCACCGGCAATGGCCTGTTCCTCAGCGAGGGCCTGAAGCTAGTGGATAAGTTTTTGGAGGATGTTAAAAAGTTGTACCACTCAGAAGCCTTCACTGTCAACTTCGGGGACACCGAAGAGGCCAAGAAACAGATCAACGATTACGTGGAGAAGGGTACTCAAGGGAAAATTGTGGATTTGGTCAAGGAGCTTGACAGAGACACAGTTTTTGCTCTGGTGAATTACATCTTCTTTAAAGGCAAATGGGAGAGACCCTTTGAAGTCAAGGACACCGAGGAAGAGGACTTCCACGTGGACCAGGTGACCACCGTGAAGGTGCCTATGATGAAGCGTTTAGGCATGTTTAACATCCAGCACTGTAAGAAGCTGTCCAGCTGGGTGCTGCTGATGAAATACCTGGGCAATGCCACCGCCATCTTCTTCCTGCCTGATGAGGGGAAACTACAGCACCTGGAAAATGAACTCACCCACGATATCATCACCAAGTTCCTGGAAAATGAAGACAGAAGGTCTGCCAGCTTACATTTACCCAAACTGTCCATTACTGGAACCTATGATCTGAAGAGCGTCCTGGGTCAACTGGGCATCACTAAGGTCTTCAGCAATGGGGCTGACCTCTCCGGGGTCACAGAGGAGGCACCCCTGAAGCTCTCCAAGGCCGTGCATAAGGCTGTGCTGACCATCGACGAGAAAGGGACTGAAGCTGCTGGGGCCATGTTTTTAGAGGCCATACCCATGTCTATCCCCCCCGAGGTCAAGTTCAACAAACCCTTTGTCTTCTTAATGATTGAACAAAATACCAAGTCTCCCCTCTTCATGGGAAAAGTGGTGAATCCCACCCAAAAATAA |
| ORF Protein Sequence | MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T28265-Ab | Anti-A1AT/ SERPINA1/ A1A functional antibody |
| Target Antigen | GM-Tg-g-T28265-Ag | SERPINA1 protein |
| ORF Viral Vector | pGMLP003894 | Human SERPINA1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001493 | Human SERPINA1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001572 | Human SERPINA1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV002164 | Human SERPINA1 Lentivirus plasmid |
| ORF Viral Vector | pGMAAV000168 | Human SERPINA1 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | pGMAP000441 | Human SERPINA1 Adenovirus plasmid |
| ORF Viral Vector | vGMLP003894 | Human SERPINA1 Lentivirus particle |
| ORF Viral Vector | vGMLV001493 | Human SERPINA1 Lentivirus particle |
| ORF Viral Vector | vGMLV001572 | Human SERPINA1 Lentivirus particle |
| ORF Viral Vector | vGMLV002164 | Human SERPINA1 Lentivirus particle |
| ORF Viral Vector | vGMAAV000168 | Human SERPINA1 Adeno-associate virus(AAV) particle |
| ORF Viral Vector | vGMAP000441 | Human SERPINA1 Adenovirus particle |
Target information
| Target ID | GM-T28265 |
| Target Name | Alpha 1 Antitrypsin/Alpha-1-antitrypsin/SERPINA1 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
5265 |
| Gene ID |
24648 (Rattus norvegicus), 280699 (Bos taurus), 480422 (Canis lupus familiaris), 5265 (Homo sapiens) 701361 (Macaca mulatta) |
| Gene Symbols & Synonyms | Serpina1,SERPINA1,Pi,AAT,Spi1,PI,A1A,PI1,A1AT,nNIF,PRO2275,alpha1AT |
| Target Alternative Names | A1A,A1AT,AAT,Alpha 1 Antitrypsin,Alpha-1 protease inhibitor,Alpha-1-antiproteinase,Alpha-1-antitrypsin,PI,PI1,PRO2275,Pi,SERPINA1,Serpin A1,Serpina1,Spi1,alpha1AT,nNIF |
| Uniprot Accession |
P01009,P17475,P34955
Additional SwissProt Accessions: P17475,P34955,P01009 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target |
| Disease | cancer, Malignant neoplasm of bladder, IgA glomerulonephritis, Nephrotic syndrome with focal and segmental glomerular lesions, Diabetic Nephropathy, Contrast - Induced Nephropathy, Congenital occlusion of ureteropelvic junction, Calculus of kidney, Nephrotic syndrome, Acute pancreatitis, Juvenile arthritis, Urinary bladder urothelial carcinoma, Type 2 diabetes mellitus with diabetic nephropathy, protease |
| Disease from KEGG | Complement and coagulation cascades |
| Gene Ensembl | ENSBTAG00000018843, ENSCAFG00845002999, ENSG00000197249, ENSMMUG00000020426 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


