Human PFN1/ALS18 ORF/cDNA clone-Lentivirus plasmid (NM_005022.4)
Cat. No.: pGMLV002114
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human PFN1/ALS18 Lentiviral expression plasmid for PFN1 lentivirus packaging, PFN1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
Profilin 1/PFN1/PFN1/ALS18 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV002114 |
Gene Name | PFN1 |
Accession Number | NM_005022.4 |
Gene ID | 5216 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 423 bp |
Gene Alias | ALS18 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 6xHis (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCGGGTGGAACGCCTACATCGACAACCTCATGGCGGACGGGACCTGTCAGGACGCGGCCATCGTGGGCTACAAGGACTCGCCCTCCGTCTGGGCCGCCGTCCCCGGGAAAACGTTCGTCAACATCACGCCAGCTGAGGTGGGTGTCCTGGTTGGCAAAGACCGGTCAAGTTTTTACGTGAATGGGCTGACACTTGGGGGCCAGAAATGTTCGGTGATCCGGGACTCACTGCTGCAGGATGGGGAATTTAGCATGGATCTTCGTACCAAGAGCACCGGTGGGGCCCCCACCTTCAATGTCACTGTCACCAAGACTGACAAGACGCTAGTCCTGCTGATGGGCAAAGAAGGTGTCCACGGTGGTTTGATCAACAAGAAATGTTATGAAATGGCCTCCCACCTTCGGCGTTCCCAGTACTGA |
ORF Protein Sequence | MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1376-Ab | Anti-PFN1 monoclonal antibody |
Target Antigen | GM-Tg-g-IP1376-Ag | PFN1 protein |
ORF Viral Vector | pGMLV002114 | Human PFN1 Lentivirus plasmid |
ORF Viral Vector | pGMAP000098 | Human PFN1 Adenovirus plasmid |
ORF Viral Vector | pGMPC001402 | Human PFN1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLV002114 | Human PFN1 Lentivirus particle |
ORF Viral Vector | vGMAP000098 | Human PFN1 Adenovirus particle |
Target information
Target ID | GM-IP1376 |
Target Name | Profilin 1/PFN1 |
Gene Group Identifier (Target Gene ID in Homo species) |
5216 |
Gene ID |
100061295 (Equus caballus), 101091824 (Felis catus), 18643 (Mus musculus), 513895 (Bos taurus) 5216 (Homo sapiens), 607397 (Canis lupus familiaris), 64303 (Rattus norvegicus), 710753 (Macaca mulatta) |
Gene Symbols & Synonyms | PFN1,Pfn1,Pfn,ALS18,profilin-1 |
Target Alternative Names | Profilin 1, PFN1,Profilin-1,Epididymis tissue protein Li 184a, Profilin I,ALS18 |
Uniprot Accession |
P02584,P07737,P62962,P62963
Additional SwissProt Accessions: P62962,P02584,P07737,P62963 |
Uniprot Entry Name | |
Protein Sub-location | Introcelluar Protein |
Category | |
Disease | Dent disease, Malignant neoplasm of bladder |
Disease from KEGG | Rap1 signaling pathway, Regulation of actin cytoskeleton |
Gene Ensembl | ENSMUSG00000018293, ENSBTAG00000004915, ENSG00000108518, ENSCAFG00845003501, ENSMMUG00000051787 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.