Human ANGPT2/AGPT2/ANG2 ORF/cDNA clone-Lentivirus plasmid (NM_001147)

Cat. No.: pGMLV002094
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ANGPT2/AGPT2/ANG2 Lentiviral expression plasmid for ANGPT2 lentivirus packaging, ANGPT2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to Angiopoietin 2/ANGPT2/ANGPT2/AGPT2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $717.48
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV002094
Gene Name ANGPT2
Accession Number NM_001147
Gene ID 285
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1491 bp
Gene Alias AGPT2,ANG2,LMPHM10
Fluorescent Reporter mCherry
Mammalian Cell Selection Blasticidin (BSD)
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGCAGATTGTTTTCTTTACTCTGAGCTGTGATCTTGTCTTGGCCGCAGCCTATAACAACTTTCGGAAGAGCATGGACAGCATAGGAAAGAAGCAATATCAGGTCCAGCATGGGTCCTGCAGCTACACTTTCCTCCTGCCAGAGATGGACAACTGCCGCTCTTCCTCCAGCCCCTACGTGTCCAATGCTGTGCAGAGGGACGCGCCGCTCGAATACGATGACTCGGTGCAGAGGCTGCAAGTGCTGGAGAACATCATGGAAAACAACACTCAGTGGCTAATGAAGCTTGAGAATTATATCCAGGACAACATGAAGAAAGAAATGGTAGAGATACAGCAGAATGCAGTACAGAACCAGACGGCTGTGATGATAGAAATAGGGACAAACCTGTTGAACCAAACAGCGGAGCAAACGCGGAAGTTAACTGATGTGGAAGCCCAAGTATTAAATCAGACCACGAGACTTGAACTTCAGCTCTTGGAACACTCCCTCTCGACAAACAAATTGGAAAAACAGATTTTGGACCAGACCAGTGAAATAAACAAATTGCAAGATAAGAACAGTTTCCTAGAAAAGAAGGTGCTAGCTATGGAAGACAAGCACATCATCCAACTACAGTCAATAAAAGAAGAGAAAGATCAGCTACAGGTGTTAGTATCCAAGCAAAATTCCATCATTGAAGAACTAGAAAAAAAAATAGTGACTGCCACGGTGAATAATTCAGTTCTTCAGAAGCAGCAACATGATCTCATGGAGACAGTTAATAACTTACTGACTATGATGTCCACATCAAACTCAGCTAAGGACCCCACTGTTGCTAAAGAAGAACAAATCAGCTTCAGAGACTGTGCTGAAGTATTCAAATCAGGACACACCACGAATGGCATCTACACGTTAACATTCCCTAATTCTACAGAAGAGATCAAGGCCTACTGTGACATGGAAGCTGGAGGAGGCGGGTGGACAATTATTCAGCGACGTGAGGATGGCAGCGTTGATTTTCAGAGGACTTGGAAAGAATATAAAGTGGGATTTGGTAACCCTTCAGGAGAATATTGGCTGGGAAATGAGTTTGTTTCGCAACTGACTAATCAGCAACGCTATGTGCTTAAAATACACCTTAAAGACTGGGAAGGGAATGAGGCTTACTCATTGTATGAACATTTCTATCTCTCAAGTGAAGAACTCAATTATAGGATTCACCTTAAAGGACTTACAGGGACAGCCGGCAAAATAAGCAGCATCAGCCAACCAGGAAATGATTTTAGCACAAAGGATGGAGACAACGACAAATGTATTTGCAAATGTTCACAAATGCTAACAGGAGGCTGGTGGTTTGATGCATGTGGTCCTTCCAACTTGAACGGAATGTACTATCCACAGAGGCAGAACACAAATAAGTTCAACGGCATTAAATGGTACTACTGGAAAGGCTCAGGCTATTCGCTCAAGGCCACAACCATGATGATCCGACCAGCAGATTTCTAA
ORF Protein Sequence MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-373 Pre-Made Nesvacumab biosimilar, Whole mAb, Anti-ANGPT2 Antibody: Anti-AGPT2/ANG2/LMPHM10 therapeutic antibody
    Biosimilar GMP-Bios-ab-612 Pre-Made Vanucizumab biosimilar, Bispecific mAb, Anti-ANGPT2;VEGFA Antibody: Anti-AGPT2/ANG2/LMPHM10;VPF/VEGF/MVCD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-641 Pre-Made Zansecimab biosimilar, Whole mAb, Anti-ANGPT2 Antibody: Anti-AGPT2/ANG2/LMPHM10 therapeutic antibody
    Biosimilar GMP-Bios-ab-204 Pre-Made Faricimab biosimilar, Bispecific mAb, Anti-VEGFA;ANGPT2 Antibody: Anti-VPF/VEGF/MVCD1;AGPT2/ANG2/LMPHM10 therapeutic antibody
    Biosimilar GMP-Bios-INN-1034 Pre-Made Trebananib Biosimilar, Fusion Protein targeting ANGPT2 fused with human IGHG1 Fc (Fragment constant): Recombinant therapeutic protein targeting AGPT2/ANG2/LMPHM10
    Target Antibody GM-Tg-g-T21960-Ab Anti-ANGP2/ ANGPT2/ AGPT2 monoclonal antibody
    Target Antigen GM-Tg-g-T21960-Ag ANGPT2 VLP (virus-like particle)
    ORF Viral Vector pGMLV001516 Human ANGPT2 Lentivirus plasmid
    ORF Viral Vector pGMLV002094 Human ANGPT2 Lentivirus plasmid
    ORF Viral Vector pGMAP000494 Human ANGPT2 Adenovirus plasmid
    ORF Viral Vector pGMPC001157 Human ANGPT2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV001516 Human ANGPT2 Lentivirus particle
    ORF Viral Vector vGMLV002094 Human ANGPT2 Lentivirus particle
    ORF Viral Vector vGMAP000494 Human ANGPT2 Adenovirus particle


    Target information

    Target ID GM-T21960
    Target Name Angiopoietin 2/ANGPT2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    285
    Gene ID 100051890 (Equus caballus), 102901787 (Felis catus), 11601 (Mus musculus), 282141 (Bos taurus)
    285 (Homo sapiens), 607616 (Canis lupus familiaris), 716811 (Macaca mulatta), 89805 (Rattus norvegicus)
    Gene Symbols & Synonyms ANGPT2,Angpt2,Ang2,Agpt2,Ang-2,ANG2,AGPT2,LMPHM10,ANG-2
    Target Alternative Names AGPT2,ANG-2,ANG2,ANGPT2,Agpt2,Ang-2,Ang2,Angiopoietin 2,Angiopoietin-2,Angpt2,LMPHM10
    Uniprot Accession A0A8J8,O15123,O35462,O35608,O77802
    Additional SwissProt Accessions: O35608,O77802,O15123,A0A8J8,O35462
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease cancer, breast cancer
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, HIF-1 signaling pathway, PI3K-Akt signaling pathway, Kaposi sarcoma-associated herpesvirus infection
    Gene Ensembl ENSECAG00000015894, ENSMUSG00000031465, ENSBTAG00000011034, ENSG00000091879, ENSCAFG00845022531, ENSMMUG00000010139
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.