Human THY1/CD90/CDw90 ORF/cDNA clone-Lentivirus plasmid (NM_001311160.2)

Cat. No.: pGMLV001723
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human THY1/CD90/CDw90 Lentiviral expression plasmid for THY1 lentivirus packaging, THY1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CD90/THY1/THY1/CD90 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001723
Gene Name THY1
Accession Number NM_001311160.2
Gene ID 7070
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 486 bp
Gene Alias CD90,CDw90
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACCTGGCCATCAGCATCGCTCTCCTGCTAACAGTCTTGCAGGTCTCCCGAGGGCAGAAGGTGACCAGCCTAACGGCCTGCCTAGTGGACCAGAGCCTTCGTCTGGACTGCCGCCATGAGAATACCAGCAGTTCACCCATCCAGTACGAGTTCAGCCTGACCCGTGAGACAAAGAAGCACGTGCTCTTTGGCACTGTGGGGGTGCCTGAGCACACATACCGCTCCCGAACCAACTTCACCAGCAAATACAACATGAAGGTCCTCTACTTATCCGCCTTCACTAGCAAGGACGAGGGCACCTACACGTGTGCACTCCACCACTCTGGCCATTCCCCACCCATCTCCTCCCAGAACGTCACAGTGCTCAGAGACAAACTGGTCAAGTGTGAGGGCATCAGCCTGCTGGCTCAGAACACCTCGTGGCTGCTGCTGCTCCTGCTCTCCCTCTCCCTCCTCCAGGCCACGGATTTCATGTCCCTGTGA
ORF Protein Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1797-Ab Anti-THY1/ CD90/ CDw90 monoclonal antibody
    Target Antigen GM-Tg-g-MP1797-Ag THY1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002825 Human THY1 Lentivirus plasmid
    ORF Viral Vector pGMLV001723 Human THY1 Lentivirus plasmid
    ORF Viral Vector vGMLP002825 Human THY1 Lentivirus particle
    ORF Viral Vector vGMLV001723 Human THY1 Lentivirus particle


    Target information

    Target ID GM-MP1797
    Target Name CD90/THY1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		7070
    Gene ID 100063377 (Equus caballus), 101098005 (Felis catus), 21838 (Mus musculus), 24832 (Rattus norvegicus)
    489365 (Canis lupus familiaris), 614712 (Bos taurus), 705321 (Macaca mulatta), 7070 (Homo sapiens)
    Gene Symbols & Synonyms THY1,Thy1,T25,CD90,Thy-1,Thy1.1,Thy1.2,Thy-1.2,CD7,CDw90
    Target Alternative Names CD7,CD90,CDw90,T25,THY1,Thy-1,Thy-1 antigen,Thy-1 membrane glycoprotein,Thy-1.2,Thy1,Thy1.1,Thy1.2
    Uniprot Accession O62643,P01830,P01831,P04216
    Additional SwissProt Accessions: P01831,P01830,O62643,P04216
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer, Prostate Cancer, Malignant neoplasm of prostate
    Disease from KEGG Leukocyte transendothelial migration
    Gene Ensembl ENSECAG00000009966, ENSMUSG00000032011, ENSCAFG00845014436, ENSMMUG00000008923, ENSG00000154096
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.