Human SMN1/BCD541/GEMIN1 ORF/cDNA clone-Lentivirus plasmid (NM_000344.4)

Cat. No.: pGMLV001700
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SMN1/BCD541/GEMIN1 Lentiviral expression plasmid for SMN1 lentivirus packaging, SMN1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SMN-Exon7/SMN1/SMN1/BCD541 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $521.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001700
Gene Name SMN1
Accession Number NM_000344.4
Gene ID 6606
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 885 bp
Gene Alias BCD541,GEMIN1,SMA,SMA1,SMA2,SMA3,SMA4,SMA@,SMN,SMNT,T-BCD541,TDRD16A
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGATGAGCAGCGGCGGCAGTGGTGGCGGCGTCCCGGAGCAGGAGGATTCCGTGCTGTTCCGGCGCGGCACAGGCCAGAGCGATGATTCTGACATTTGGGATGATACAGCACTGATAAAAGCATATGATAAAGCTGTGGCTTCATTTAAGCATGCTCTAAAGAATGGTGACATTTGTGAAACTTCGGGTAAACCAAAAACCACACCTAAAAGAAAACCTGCTAAGAAGAATAAAAGCCAAAAGAAGAATACTGCAGCTTCCTTACAACAGTGGAAAGTTGGGGACAAATGTTCTGCCATTTGGTCAGAAGACGGTTGCATTTACCCAGCTACCATTGCTTCAATTGATTTTAAGAGAGAAACCTGTGTTGTGGTTTACACTGGATATGGAAATAGAGAGGAGCAAAATCTGTCCGATCTACTTTCCCCAATCTGTGAAGTAGCTAATAATATAGAACAAAATGCTCAAGAGAATGAAAATGAAAGCCAAGTTTCAACAGATGAAAGTGAGAACTCCAGGTCTCCTGGAAATAAATCAGATAACATCAAGCCCAAATCTGCTCCATGGAACTCTTTTCTCCCTCCACCACCCCCCATGCCAGGGCCAAGACTGGGACCAGGAAAGCCAGGTCTAAAATTCAATGGCCCACCACCGCCACCGCCACCACCACCACCCCACTTACTATCATGCTGGCTGCCTCCATTTCCTTCTGGACCACCAATAATTCCCCCACCACCTCCCATATGTCCAGATTCTCTTGATGATGCTGATGCTTTGGGAAGTATGTTAATTTCATGGTACATGAGTGGCTATCATACTGGCTATTATATGGGTTTCAGACAAAATCAAAAAGAAGGAAGGTGCTCACATTCCTTAAATTAA
ORF Protein Sequence MAMSSGGSGGGVPEQEDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPICEVANNIEQNAQENENESQVSTDESENSRSPGNKSDNIKPKSAPWNSFLPPPPPMPGPRLGPGKPGLKFNGPPPPPPPPPPHLLSCWLPPFPSGPPIIPPPPPICPDSLDDADALGSMLISWYMSGYHTGYYMGFRQNQKEGRCSHSLN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T71907-Ab Anti-SMN1 monoclonal antibody
    Target Antigen GM-Tg-g-T71907-Ag SMN1 protein
    ORF Viral Vector pGMLP000812 Human SMN1 Lentivirus plasmid
    ORF Viral Vector pGMLP000891 Human SMN2 Lentivirus plasmid
    ORF Viral Vector pGMLV001700 Human SMN1 Lentivirus plasmid
    ORF Viral Vector vGMLP000812 Human SMN1 Lentivirus particle
    ORF Viral Vector vGMLP000891 Human SMN2 Lentivirus particle
    ORF Viral Vector vGMLV001700 Human SMN1 Lentivirus particle


    Target information

    Target ID GM-T71907
    Target Name SMN-Exon7/SMN1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6606
    Gene ID 6606 (Homo sapiens), 677703 (Macaca mulatta)
    Gene Symbols & Synonyms SMN1,SMA,SMN,SMA1,SMA2,SMA3,SMA4,SMA@,SMNT,BCD541,GEMIN1,TDRD16A,T-BCD541
    Target Alternative Names SMN-Exon7, SMN1,Survival motor neuron protein,Component of gems 1, Gemin-1,SMA,SMN,SMA1,SMA2,SMA3,SMA4,SMA@,SMNT,BCD541,GEMIN1,TDRD16A,T-BCD541
    Uniprot Accession Q16637
    Additional SwissProt Accessions: Q16637
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG
    Gene Ensembl ENSG00000172062, ENSMMUG00000020214
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.