Human CCN5/CT58/CTGF-L ORF/cDNA clone-Lentivirus plasmid (NM_003881.4)
Cat. No.: pGMLV001674
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CCN5/CT58/CTGF-L Lentiviral expression plasmid for CCN5 lentivirus packaging, CCN5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CCN5/CT58 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV001674 |
Gene Name | CCN5 |
Accession Number | NM_003881.4 |
Gene ID | 8839 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 753 bp |
Gene Alias | CT58,CTGF-L,WISP2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGAGGCACACCGAAGACCCACCTCCTGGCCTTCTCCCTCCTCTGCCTCCTCTCAAAGGTGCGTACCCAGCTGTGCCCGACACCATGTACCTGCCCCTGGCCACCTCCCCGATGCCCGCTGGGAGTACCCCTGGTGCTGGATGGCTGTGGCTGCTGCCGGGTATGTGCACGGCGGCTGGGGGAGCCCTGCGACCAACTCCACGTCTGCGACGCCAGCCAGGGCCTGGTCTGCCAGCCCGGGGCAGGACCCGGTGGCCGGGGGGCCCTGTGCCTCTTGGCAGAGGACGACAGCAGCTGTGAGGTGAACGGCCGCCTGTATCGGGAAGGGGAGACCTTCCAGCCCCACTGCAGCATCCGCTGCCGCTGCGAGGACGGCGGCTTCACCTGCGTGCCGCTGTGCAGCGAGGATGTGCGGCTGCCCAGCTGGGACTGCCCCCACCCCAGGAGGGTCGAGGTCCTGGGCAAGTGCTGCCCTGAGTGGGTGTGCGGCCAAGGAGGGGGACTGGGGACCCAGCCCCTTCCAGCCCAAGGACCCCAGTTTTCTGGCCTTGTCTCTTCCCTGCCCCCTGGTGTCCCCTGCCCAGAATGGAGCACGGCCTGGGGACCCTGCTCGACCACCTGTGGGCTGGGCATGGCCACCCGGGTGTCCAACCAGAACCGCTTCTGCCGACTGGAGACCCAGCGCCGCCTGTGCCTGTCCAGGCCCTGCCCACCCTCCAGGGGTCGCAGTCCACAAAACAGTGCCTTCTAG |
ORF Protein Sequence | MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0753-Ab | Anti-CCN5/ CT58/ CTGF-L functional antibody |
Target Antigen | GM-Tg-g-SE0753-Ag | CCN5 protein |
ORF Viral Vector | pGMLV001674 | Human CCN5 Lentivirus plasmid |
ORF Viral Vector | vGMLV001674 | Human CCN5 Lentivirus particle |
Target information
Target ID | GM-SE0753 |
Target Name | CCN5 |
Gene Group Identifier (Target Gene ID in Homo species) |
8839 |
Gene ID |
100070779 (Equus caballus), 101091930 (Felis catus), 22403 (Mus musculus), 29576 (Rattus norvegicus) 534658 (Bos taurus), 610928 (Canis lupus familiaris), 717872 (Macaca mulatta), 8839 (Homo sapiens) |
Gene Symbols & Synonyms | CCN5,Ccn5,WISP2,Crgr4,Ctgfl,Rcop1,Wisp2,CT58,CTGF-L |
Target Alternative Names | CCN5,CCN family member 5,Connective tissue growth factor-like protein (CTGF-L), Connective tissue growth factor-related protein 58, WNT1-inducible-signaling pathway protein 2 (WISP-2),CT58,WISP2,CTGF-L |
Uniprot Accession |
O76076,Q9JHC6,Q9Z0G4
Additional SwissProt Accessions: Q9Z0G4,Q9JHC6,O76076 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | |
Disease | cancer |
Disease from KEGG | |
Gene Ensembl | ENSECAG00000014566, ENSMUSG00000027656, ENSBTAG00000006037, ENSCAFG00845013975, ENSMMUG00000045256, ENSG00000064205 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.