Human CCN5/CT58/CTGF-L ORF/cDNA clone-Lentivirus plasmid (NM_003881.4)

Cat. No.: pGMLV001674
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCN5/CT58/CTGF-L Lentiviral expression plasmid for CCN5 lentivirus packaging, CCN5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CCN5/CT58 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $488.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001674
Gene Name CCN5
Accession Number NM_003881.4
Gene ID 8839
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 753 bp
Gene Alias CT58,CTGF-L,WISP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGAGGCACACCGAAGACCCACCTCCTGGCCTTCTCCCTCCTCTGCCTCCTCTCAAAGGTGCGTACCCAGCTGTGCCCGACACCATGTACCTGCCCCTGGCCACCTCCCCGATGCCCGCTGGGAGTACCCCTGGTGCTGGATGGCTGTGGCTGCTGCCGGGTATGTGCACGGCGGCTGGGGGAGCCCTGCGACCAACTCCACGTCTGCGACGCCAGCCAGGGCCTGGTCTGCCAGCCCGGGGCAGGACCCGGTGGCCGGGGGGCCCTGTGCCTCTTGGCAGAGGACGACAGCAGCTGTGAGGTGAACGGCCGCCTGTATCGGGAAGGGGAGACCTTCCAGCCCCACTGCAGCATCCGCTGCCGCTGCGAGGACGGCGGCTTCACCTGCGTGCCGCTGTGCAGCGAGGATGTGCGGCTGCCCAGCTGGGACTGCCCCCACCCCAGGAGGGTCGAGGTCCTGGGCAAGTGCTGCCCTGAGTGGGTGTGCGGCCAAGGAGGGGGACTGGGGACCCAGCCCCTTCCAGCCCAAGGACCCCAGTTTTCTGGCCTTGTCTCTTCCCTGCCCCCTGGTGTCCCCTGCCCAGAATGGAGCACGGCCTGGGGACCCTGCTCGACCACCTGTGGGCTGGGCATGGCCACCCGGGTGTCCAACCAGAACCGCTTCTGCCGACTGGAGACCCAGCGCCGCCTGTGCCTGTCCAGGCCCTGCCCACCCTCCAGGGGTCGCAGTCCACAAAACAGTGCCTTCTAG
ORF Protein Sequence MRGTPKTHLLAFSLLCLLSKVRTQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0753-Ab Anti-CCN5/ CT58/ CTGF-L functional antibody
    Target Antigen GM-Tg-g-SE0753-Ag CCN5 protein
    ORF Viral Vector pGMLV001674 Human CCN5 Lentivirus plasmid
    ORF Viral Vector vGMLV001674 Human CCN5 Lentivirus particle


    Target information

    Target ID GM-SE0753
    Target Name CCN5
    Gene Group Identifier
    (Target Gene ID in Homo species)
    8839
    Gene ID 100070779 (Equus caballus), 101091930 (Felis catus), 22403 (Mus musculus), 29576 (Rattus norvegicus)
    534658 (Bos taurus), 610928 (Canis lupus familiaris), 717872 (Macaca mulatta), 8839 (Homo sapiens)
    Gene Symbols & Synonyms CCN5,Ccn5,WISP2,Crgr4,Ctgfl,Rcop1,Wisp2,CT58,CTGF-L
    Target Alternative Names CCN5,CCN family member 5,Connective tissue growth factor-like protein (CTGF-L), Connective tissue growth factor-related protein 58, WNT1-inducible-signaling pathway protein 2 (WISP-2),CT58,WISP2,CTGF-L
    Uniprot Accession O76076,Q9JHC6,Q9Z0G4
    Additional SwissProt Accessions: Q9Z0G4,Q9JHC6,O76076
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000014566, ENSMUSG00000027656, ENSBTAG00000006037, ENSCAFG00845013975, ENSMMUG00000045256, ENSG00000064205
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.