Human CCL5/D17S136E/eoCP ORF/cDNA clone-Lentivirus plasmid (NM_002985.3)

Cat. No.: pGMLV001580
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCL5/D17S136E/eoCP Lentiviral expression plasmid for CCL5 lentivirus packaging, CCL5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RANTES/CCL5/CCL5/D17S136E products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001580
Gene Name CCL5
Accession Number NM_002985.3
Gene ID 6352
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 276 bp
Gene Alias D17S136E,eoCP,RANTES,SCYA5,SIS-delta,SISd,TCP228
Fluorescent Reporter null
Mammalian Cell Selection Neomycin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGGTCTCCGCGGCAGCCCTCGCTGTCATCCTCATTGCTACTGCCCTCTGCGCTCCTGCATCTGCCTCCCCATATTCCTCGGACACCACACCCTGCTGCTTTGCCTACATTGCCCGCCCACTGCCCCGTGCCCACATCAAGGAGTATTTCTACACCAGTGGCAAGTGCTCCAACCCAGCAGTCGTCTTTGTCACCCGAAAGAACCGCCAAGTGTGTGCCAACCCAGAGAAGAAATGGGTTCGGGAGTACATCAACTCTTTGGAGATGAGCTAG
ORF Protein Sequence MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T16263-Ab Anti-CCL5/ D17S136E/ RANTES functional antibody
    Target Antigen GM-Tg-g-T16263-Ag CCL5 protein
    Cytokine cks-Tg-g-GM-T16263 chemokine (C-C motif) ligand 5 (CCL5) protein & antibody
    ORF Viral Vector pGMLV001580 Human CCL5 Lentivirus plasmid
    ORF Viral Vector pGMLV001626 Human CCL5 Lentivirus plasmid
    ORF Viral Vector pGMLV001699 Human CCL5 Lentivirus plasmid
    ORF Viral Vector pGMLV001882 Human CCL5 Lentivirus plasmid
    ORF Viral Vector pGMAP000013 Human CCL5 Adenovirus plasmid
    ORF Viral Vector pGMAP000062 Human CCL5 Adenovirus plasmid
    ORF Viral Vector pGMPC000787 Human CCL5 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV001580 Human CCL5 Lentivirus particle
    ORF Viral Vector vGMLV001626 Human CCL5 Lentivirus particle
    ORF Viral Vector vGMLV001699 Human CCL5 Lentivirus particle
    ORF Viral Vector vGMLV001882 Human CCL5 Lentivirus particle
    ORF Viral Vector vGMAP000013 Human CCL5 Adenovirus particle
    ORF Viral Vector vGMAP000062 Human CCL5 Adenovirus particle


    Target information

    Target ID GM-T16263
    Target Name RANTES/CCL5
    Gene Group Identifier
    （Target Gene ID in Homo species)         		6352
    Gene ID 100033925 (Equus caballus), 20304 (Mus musculus), 327712 (Bos taurus), 403522 (Canis lupus familiaris)
    493689 (Felis catus), 574178 (Macaca mulatta), 6352 (Homo sapiens), 81780 (Rattus norvegicus)
    Gene Symbols & Synonyms CCL5,Ccl5,SCYA5,RANTES,SISd,Scya5,TCP228,MuRantes,eoCP,D17S136E,SIS-delta,Rantes
    Target Alternative Names C-C motif chemokine 5,CCL5,Ccl5,D17S136E,EoCP,Eosinophil chemotactic cytokine,MuRantes,RANTES,Rantes,SCYA5,SIS-delta,SISd,Scya5,Small-inducible cytokine A5,T cell-specific protein P228 (TCP228),T-cell-specific protein RANTES,TCP228,eoCP
    Uniprot Accession O97919,P13501,P30882,P50231,Q8HYQ1,Q8HYS0,Q8MKD0,Q8SQ40
    Additional SwissProt Accessions: Q8MKD0,P30882,O97919,Q8HYS0,Q8SQ40,Q8HYQ1,P13501,P50231
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease cancer, Breast Cancer, Type 1 diabetes mellitus, Chronic Kidney Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, TNF signaling pathway, Epithelial cell signaling in Helicobacter pylori infection, Chagas disease, Human cytomegalovirus infection, Influenza A, Rheumatoid arthritis, Lipid and atherosclerosis
    Gene Ensembl ENSMUSG00000035042, ENSBTAG00000066072, ENSMMUG00000054796, ENSG00000271503
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.