Human RAC1/MIG5/MRD48 ORF/cDNA clone-Lentivirus plasmid (NM_006908.5)

Cat. No.: pGMLV001569
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RAC1/MIG5/MRD48 Lentiviral expression plasmid for RAC1 lentivirus packaging, RAC1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RAC1/Rac1/RAC1/MIG5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $444.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001569
Gene Name RAC1
Accession Number NM_006908.5
Gene ID 5879
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 579 bp
Gene Alias MIG5,MRD48,p21-Rac1,Rac-1,TC-25
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGGCCATCAAGTGTGTGGTGGTGGGAGACGGAGCTGTAGGTAAAACTTGCCTACTGATCAGTTACACAACCAATGCATTTCCTGGAGAATATATCCCTACTGTCTTTGACAATTATTCTGCCAATGTTATGGTAGATGGAAAACCGGTGAATCTGGGCTTATGGGATACAGCTGGACAAGAAGATTATGACAGATTACGCCCCCTATCCTATCCGCAAACAGATGTGTTCTTAATTTGCTTTTCCCTTGTGAGTCCTGCATCATTTGAAAATGTCCGTGCAAAGTGGTATCCTGAGGTGCGGCACCACTGTCCCAACACTCCCATCATCCTAGTGGGAACTAAACTTGATCTTAGGGATGATAAAGACACGATCGAGAAACTGAAGGAGAAGAAGCTGACTCCCATCACCTATCCGCAGGGTCTAGCCATGGCTAAGGAGATTGGTGCTGTAAAATACCTGGAGTGCTCGGCGCTCACACAGCGAGGCCTCAAGACAGTGTTTGACGAAGCGATCCGAGCAGTCCTCTGCCCGCCTCCCGTGAAGAAGAGGAAGAGAAAATGCCTGCTGTTGTAA
ORF Protein Sequence MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T88752-Ab Anti-RAC1 monoclonal antibody
    Target Antigen GM-Tg-g-T88752-Ag RAC1 protein
    ORF Viral Vector pGMLP005650 Human RAC1 Lentivirus plasmid
    ORF Viral Vector pGMLV000095 Human RAC1 Lentivirus plasmid
    ORF Viral Vector pGMLV000177 Human RAC1 Lentivirus plasmid
    ORF Viral Vector pGMLV000178 Human RAC1 Lentivirus plasmid
    ORF Viral Vector pGMLV000896 Human RAC1 Lentivirus plasmid
    ORF Viral Vector pGMLV001452 Human RAC1 Lentivirus plasmid
    ORF Viral Vector pGMLV001569 Human RAC1 Lentivirus plasmid
    ORF Viral Vector pGMLV002007 Human RAC1 Lentivirus plasmid
    ORF Viral Vector pGMAP000586 Human RAC1 Adenovirus plasmid
    ORF Viral Vector pGMPC000091 Human RAC1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000573 Human RAC1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP005650 Human RAC1 Lentivirus particle
    ORF Viral Vector vGMLV000095 Human RAC1 Lentivirus particle
    ORF Viral Vector vGMLV000177 Human RAC1 Lentivirus particle
    ORF Viral Vector vGMLV000178 Human RAC1 Lentivirus particle
    ORF Viral Vector vGMLV000896 Human RAC1 Lentivirus particle
    ORF Viral Vector vGMLV001452 Human RAC1 Lentivirus particle
    ORF Viral Vector vGMLV001569 Human RAC1 Lentivirus particle
    ORF Viral Vector vGMLV002007 Human RAC1 Lentivirus particle
    ORF Viral Vector vGMAP000586 Human RAC1 Adenovirus particle


    Target information

    Target ID GM-T88752
    Target Name RAC1/Rac1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5879
    Gene ID 100061732 (Equus caballus), 101101277 (Felis catus), 19353 (Mus musculus), 281440 (Bos taurus)
    363875 (Rattus norvegicus), 403955 (Canis lupus familiaris), 5879 (Homo sapiens), 717755 (Macaca mulatta)
    Gene Symbols & Synonyms RAC1,Rac1,D5Ertd559e,RAC2,MIG5,MRD48,Rac-1,TC-25,p21-Rac1
    Target Alternative Names Cell migration-inducing gene 5 protein,D5Ertd559e,MIG5,MRD48,RAC1,RAC2,Rac-1,Rac1,Ras-like protein TC25,Ras-related C3 botulinum toxin substrate 1,TC-25,p21-Rac1
    Uniprot Accession P62998,P62999,P63000,P63001,Q6RUV5
    Additional SwissProt Accessions: P63001,P62998,Q6RUV5,P62999,P63000
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer, Breast Cancer
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, cAMP signaling pathway, Chemokine signaling pathway, Sphingolipid signaling pathway, Phagosome, PI3K-Akt signaling pathway, Wnt signaling pathway, Axon guidance, Osteoclast differentiation, Focal adhesion, Adherens junction, Tight junction, Toll-like receptor signaling pathway, Natural killer cell mediated cytotoxicity, B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Leukocyte transendothelial migration, Neurotrophin signaling pathway, Regulation of actin cytoskeleton, AGE-RAGE signaling pathway in diabetic complications, Pancreatic secretion, Epithelial cell signaling in Helicobacter pylori infection, Pathogenic Escherichia coli infection, Yersinia infection, Human cytomegalovirus infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Pathways in cancer, Proteoglycans in cancer, Colorectal cancer, Renal cell carcinoma, Pancreatic cancer, Choline metabolism in cancer, Viral myocarditis, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis
    Gene Ensembl ENSECAG00000009727, ENSMUSG00000001847, ENSBTAG00000053390, ENSCAFG00845010961, ENSG00000136238, ENSMMUG00000021075
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.