Human CMTM4/CKLFSF4 ORF/cDNA clone-Lentivirus plasmid (NM_178818.3)

Cat. No.: pGMLV001505
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CMTM4/CKLFSF4 Lentiviral expression plasmid for CMTM4 lentivirus packaging, CMTM4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CMTM4/CKLFSF4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $476.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001505
Gene Name CMTM4
Accession Number NM_178818.3
Gene ID 146223
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 705 bp
Gene Alias CKLFSF4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGGAGCGGCGAGGAGCTGGACGGCTTCGAGGGCGAGGCCTCGAGCACCTCCATGATCTCGGGCGCCAGCAGCCCGTACCAGCCCACCACCGAGCCGGTGAGCCAGCGCCGCGGGCTGGCCGGCCTGCGCTGCGACCCCGACTACCTGCGCGGCGCGCTCGGCCGCCTCAAGGTCGCCCAAGTGATCTTGGCCCTGATTGCATTCATCTGCATAGAGACCATCATGGCATGCTCCCCGTGTGAAGGCCTCTACTTTTTTGAGTTTGTGAGCTGCAGTGCGTTTGTGGTGACTGGCGTCTTGCTGATTATGTTCAGTCTCAACCTGCACATGAGGATCCCCCAGATCAACTGGAATCTGACAGATTTGGTCAACACTGGACTCAGCGCTTTCCTTTTCTTTATTGCTTCAATCGTACTGGCTGCTTTAAACCATAGAGCCGGAGCAGAAATTGCTGCCGTGATATTTGGCTTCTTGGCGACTGCGGCATATGCAGTGAACACATTCCTGGCAGTGCAGAAATGGAGAGTCAGCGTCCGCCAGCAGAGCACCAATGACTACATCCGAGCCCGCACGGAGTCCAGGGATGTGGACAGTCGCCCTGAGATCCAGCGCCTGGACACTTTTTCCTACTCCACAAACGTAACAGTAAGGAAAAAATCACCCACAAACCTGCTGAGTTTGAATCACTGGCAACTTGCCTAG
ORF Protein Sequence MRSGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMACSPCEGLYFFEFVSCSAFVVTGVLLIMFSLNLHMRIPQINWNLTDLVNTGLSAFLFFIASIVLAALNHRAGAEIAAVIFGFLATAAYAVNTFLAVQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0574-Ab Anti-CMTM4 monoclonal antibody
    Target Antigen GM-Tg-g-IP0574-Ag CMTM4 protein
    ORF Viral Vector pGMLV001505 Human CMTM4 Lentivirus plasmid
    ORF Viral Vector pGMAD000487 Human CMTM4 Adenovirus plasmid
    ORF Viral Vector vGMLV001505 Human CMTM4 Lentivirus particle
    ORF Viral Vector vGMAD000487 Human CMTM4 Adenovirus particle


    Target information

    Target ID GM-IP0574
    Target Name CMTM4
    Gene Group Identifier
    (Target Gene ID in Homo species)
    146223
    Gene ID 100065469 (Equus caballus), 101086023 (Felis catus), 146223 (Homo sapiens), 498902 (Rattus norvegicus)
    540247 (Bos taurus), 611358 (Canis lupus familiaris), 695709 (Macaca mulatta), 97487 (Mus musculus)
    Gene Symbols & Synonyms CMTM4,Cmtm4,CKLFSF4,Cklfsf4,RGD1565098,Gm9853
    Target Alternative Names CKLF-like MARVEL transmembrane domain-containing protein 4,CKLFSF4,CMTM4,Chemokine-like factor superfamily member 4,Cklfsf4,Cmtm4,Gm9853,RGD1565098
    Uniprot Accession Q8CJ61,Q8IZR5
    Additional SwissProt Accessions: Q8IZR5,Q8CJ61
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000018456, ENSG00000183723, ENSBTAG00000001104, ENSCAFG00845011632, ENSMUSG00000096188
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.