Human SNCA/NACP/PARK1 ORF/cDNA clone-Lentivirus plasmid (NM_000345.4)

Cat. No.: pGMLV001492
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SNCA/NACP/PARK1 Lentiviral expression plasmid for SNCA lentivirus packaging, SNCA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to Alpha Synuclein/SNCA/SNCA/NACP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001492
Gene Name SNCA
Accession Number NM_000345.4
Gene ID 6622
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 423 bp
Gene Alias NACP,PARK1,PARK4,PD1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATGTATTCATGAAAGGACTTTCAAAGGCCAAGGAGGGAGTTGTGGCTGCTGCTGAGAAAACCAAACAGGGTGTGGCAGAAGCAGCAGGAAAGACAAAAGAGGGTGTTCTCTATGTAGGCTCCAAAACCAAGGAGGGAGTGGTGCATGGTGTGGCAACAGTGGCTGAGAAGACCAAAGAGCAAGTGACAAATGTTGGAGGAGCAGTGGTGACGGGTGTGACAGCAGTAGCCCAGAAGACAGTGGAGGGAGCAGGGAGCATTGCAGCAGCCACTGGCTTTGTCAAAAAGGACCAGTTGGGCAAGAATGAAGAAGGAGCCCCACAGGAAGGAATTCTGGAAGATATGCCTGTGGATCCTGACAATGAGGCTTATGAAATGCCTTCTGAGGAAGGGTATCAAGACTACGAACCTGAAGCCTAA
ORF Protein Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-106 Pre-Made Cinpanemab biosimilar, Whole mAb, Anti-SNCA Antibody: Anti-NACP/PARK1/PARK4/PD1 therapeutic antibody
    Biosimilar GMP-Bios-ab-455 Pre-Made Prasinezumab biosimilar, Whole mAb, Anti-SNCA Antibody: Anti-NACP/PARK1/PARK4/PD1 therapeutic antibody
    Target Antibody GM-Tg-g-T03644-Ab Anti-SYUA/ SNCA/ NACP monoclonal antibody
    Target Antigen GM-Tg-g-T03644-Ag SNCA VLP (virus-like particle)
    ORF Viral Vector pGMLV000451 Human SNCA Lentivirus plasmid
    ORF Viral Vector pGMLV000666 Human snca Lentivirus plasmid
    ORF Viral Vector pGMLV001108 Human SNCA Lentivirus plasmid
    ORF Viral Vector pGMLV001492 Human SNCA Lentivirus plasmid
    ORF Viral Vector pGMAD000007 Human SNCA Adenovirus plasmid
    ORF Viral Vector pGMAAV000133 Human SNCA Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAAV000397 Human SNCA Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAAV000411 Human SNCA Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAAV000557 Human SNCA Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAAV000965 Human SNCA Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAAV000966 Human SNCA Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAAV001373 Human SNCA Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAAV001660 Human SNCA Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAP000427 Human SNCA Adenovirus plasmid
    ORF Viral Vector pGMPC001356 Human SNCA Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV000451 Human SNCA Lentivirus particle
    ORF Viral Vector vGMLV000666 Human snca Lentivirus particle
    ORF Viral Vector vGMLV001108 Human SNCA Lentivirus particle
    ORF Viral Vector vGMLV001492 Human SNCA Lentivirus particle
    ORF Viral Vector vGMAD000007 Human SNCA Adenovirus particle
    ORF Viral Vector vGMAAV000133 Human SNCA Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAAV000397 Human SNCA Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAAV000411 Human SNCA Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAAV000557 Human SNCA Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAAV000965 Human SNCA Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAAV000966 Human SNCA Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAAV001373 Human SNCA Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAAV001660 Human SNCA Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAP000427 Human SNCA Adenovirus particle


    Target information

    Target ID GM-T03644
    Target Name Alpha Synuclein/SNCA
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6622
    Gene ID 100053270 (Equus caballus), 101091694 (Felis catus), 20617 (Mus musculus), 282857 (Bos taurus)
    29219 (Rattus norvegicus), 478478 (Canis lupus familiaris), 6622 (Homo sapiens), 706985 (Macaca mulatta)
    Gene Symbols & Synonyms SNCA,Snca,NACP,alphaSYN,alpha-Syn,PD1,PARK1,PARK4
    Target Alternative Names Alpha Synuclein, SNCA,Alpha-synuclein,Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor (NACP),PD1,NACP,PARK1,PARK4
    Uniprot Accession O55042,P37377,P37840,P61143,Q3T0G8
    Additional SwissProt Accessions: O55042,Q3T0G8,P37377,P37840,P61143
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Diagnostics Biomarker, INN Index
    Disease
    Disease from KEGG Alzheimer disease
    Gene Ensembl ENSECAG00000015766, ENSMUSG00000025889, ENSBTAG00000024957, ENSCAFG00845019506, ENSG00000145335, ENSMMUG00000012123
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.