Human CD3E/IMD18/T3E ORF/cDNA clone-Lentivirus plasmid (NM-000733)
Cat. No.: pGMLV001402
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CD3E/IMD18/T3E Lentiviral expression plasmid for CD3E lentivirus packaging, CD3E lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CD3/CD3E/CD3e/CD3E/IMD18 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV001402 |
| Gene Name | CD3E |
| Accession Number | NM-000733 |
| Gene ID | 916 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 624 bp |
| Gene Alias | IMD18,T3E,TCRE |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGCAGTCGGGCACTCACTGGAGAGTTCTGGGCCTCTGCCTCTTATCAGTTGGCGTTTGGGGGCAAGATGGTAATGAAGAAATGGGTGGTATTACACAGACACCATATAAAGTCTCCATCTCTGGAACCACAGTAATATTGACATGCCCTCAGTATCCTGGATCTGAAATACTATGGCAACACAATGATAAAAACATAGGCGGTGATGAGGATGATAAAAACATAGGCAGTGATGAGGATCACCTGTCACTGAAGGAATTTTCAGAATTGGAGCAAAGTGGTTATTATGTCTGCTACCCCAGAGGAAGCAAACCAGAAGATGCGAACTTTTATCTCTACCTGAGGGCAAGAGTGTGTGAGAACTGCATGGAGATGGATGTGATGTCGGTGGCCACAATTGTCATAGTGGACATCTGCATCACTGGGGGCTTGCTGCTGCTGGTTTACTACTGGAGCAAGAATAGAAAGGCCAAGGCCAAGCCTGTGACACGAGGAGCGGGTGCTGGCGGCAGGCAAAGGGGACAAAACAAGGAGAGGCCACCACCTGTTCCCAACCCAGACTATGAGCCCATCCGGAAAGGCCAGCGGGACCTGTATTCTGGCCTGAATCAGAGACGCATCTGA |
| ORF Protein Sequence | MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Target information
| Target ID | GM-T87075 |
| Target Name | CD3/CD3E/CD3e |
|
Gene Group Identifier (Target Gene ID in Homo species) |
916 |
| Gene ID |
100629532 (Equus caballus), 12501 (Mus musculus), 281054 (Bos taurus), 315609 (Rattus norvegicus) 442981 (Canis lupus familiaris), 493936 (Felis catus), 699467 (Macaca mulatta), 916 (Homo sapiens) |
| Gene Symbols & Synonyms | CD3E,Cd3e,CD3,T3e,CD3epsilon,T3E,TCRE,IMD18 |
| Target Alternative Names | CD3,CD3E,CD3e,CD3epsilon,Cd3e,IMD18,T-cell surface antigen T3/Leu-4 epsilon chain,T-cell surface glycoprotein CD3 epsilon chain,T3E,T3e,TCRE |
| Uniprot Accession |
P07766,P22646,P27597,Q28073,Q5R1Q1
Additional SwissProt Accessions: P22646,Q28073,P27597,Q5R1Q1,P07766 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Immuno-oncology Target, INN Index |
| Disease | |
| Disease from KEGG | Hematopoietic cell lineage, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Chagas disease, Measles, Human T-cell leukemia virus 1 infection, Epstein-Barr virus infection, PD-L1 expression and PD-1 checkpoint pathway in cancer |
| Gene Ensembl | ENSECAG00000014635, ENSMUSG00000032093, ENSBTAG00000015710, ENSCAFG00845002518, ENSMMUG00000017593, ENSG00000198851 |
| Target Classification | Checkpoint-Immuno Oncology |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


