Human PTP4A3/PRL-3/PRL-R ORF/cDNA clone-Lentivirus plasmid (NM_007079.3)

Cat. No.: pGMLV001318
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PTP4A3/PRL-3/PRL-R Lentiviral expression plasmid for PTP4A3 lentivirus packaging, PTP4A3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PRL3/PTP4A3/PRL-3/PTP4A3/PRL-3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001318
Gene Name PTP4A3
Accession Number NM_007079.3
Gene ID 11156
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 447 bp
Gene Alias PRL-3,PRL-R,PRL3
Fluorescent Reporter mCherry
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCGGATGAACCGCCCGGCCCCGGTGGAGGTGAGCTACAAACACATGCGCTTCCTCATCACCCACAACCCCACCAACGCCACGCTCAGCACCTTCATTGAGGACCTGAAGAAGTACGGGGCTACCACTGTGGTGCGTGTGTGTGAAGTGACCTATGACAAAACGCCGCTGGAGAAGGATGGCATCACCGTTGTGGACTGGCCGTTTGACGATGGGGCGCCCCCGCCCGGCAAGGTAGTGGAAGACTGGCTGAGCCTGGTGAAGGCCAAGTTCTGTGAGGCCCCCGGCAGCTGCGTGGCTGTGCACTGCGTGGCGGGCCTGGGCCGGAAGCGCCGCGGAGCCATCAACAGCAAGCAGCTCACCTACCTGGAGAAATACCGGCCCAAACAGAGGCTGCGGTTCAAAGACCCACACACGCACAAGACCCGGTGCTGCGTTATGTAG
ORF Protein Sequence MARMNRPAPVEVSYKHMRFLITHNPTNATLSTFIEDLKKYGATTVVRVCEVTYDKTPLEKDGITVVDWPFDDGAPPPGKVVEDWLSLVKAKFCEAPGSCVAVHCVAGLGRKRRGAINSKQLTYLEKYRPKQRLRFKDPHTHKTRCCVM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T78019-Ab Anti-PRL-3 monoclonal antibody
    Target Antigen GM-Tg-g-T78019-Ag PRL-3/PTP4A3 protein
    ORF Viral Vector pGMLP000864 Human PTP4A3 Lentivirus plasmid
    ORF Viral Vector pGMLV001318 Human PTP4A3 Lentivirus plasmid
    ORF Viral Vector vGMLP000864 Human PTP4A3 Lentivirus particle
    ORF Viral Vector vGMLV001318 Human PTP4A3 Lentivirus particle


    Target information

    Target ID GM-T78019
    Target Name PRL3/PTP4A3/PRL-3
    Gene Group Identifier
    （Target Gene ID in Homo species)         		11156
    Gene ID 100058296 (Equus caballus), 100137722 (Bos taurus), 101096639 (Felis catus), 11156 (Homo sapiens)
    19245 (Mus musculus), 362930 (Rattus norvegicus), 606961 (Canis lupus familiaris), 693703 (Macaca mulatta)
    Gene Symbols & Synonyms PTP4A3,Ptp4a3,PRL3,PRL-3,PRL-R,Prl-3,pPtp4a3
    Target Alternative Names PRL-3,PRL-R,PRL3,PTP4A3,Prl-3,Protein tyrosine phosphatase type IVA 3,Protein-tyrosine phosphatase 4a3,Protein-tyrosine phosphatase of regenerating liver 3 (PRL-3),Ptp4a3,pPtp4a3
    Uniprot Accession O75365,Q9D658
    Additional SwissProt Accessions: O75365,Q9D658
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000030951, ENSBTAG00000046467, ENSG00000184489, ENSMUSG00000059895, ENSCAFG00845013289, ENSMMUG00000019392
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.