Human HSPB1/CMT2F/HEL-S-102 ORF/cDNA clone-Lentivirus plasmid (NM_001540.3)

Cat. No.: pGMLV001124
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HSPB1/CMT2F/HEL-S-102 Lentiviral expression plasmid for HSPB1 lentivirus packaging, HSPB1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to HSP27/HSPB1/HSP20/HSPB1/CMT2F products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $454.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001124
Gene Name HSPB1
Accession Number NM_001540.3
Gene ID 3315
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 618 bp
Gene Alias CMT2F,HEL-S-102,HMN2B,HS.76067,Hsp25,HSP27,HSP28,SRP27
Fluorescent Reporter null
Mammalian Cell Selection Neomycin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCGAGCGCCGCGTCCCCTTCTCGCTCCTGCGGGGCCCCAGCTGGGACCCCTTCCGCGACTGGTACCCGCATAGCCGCCTCTTCGACCAGGCCTTCGGGCTGCCCCGGCTGCCGGAGGAGTGGTCGCAGTGGTTAGGCGGCAGCAGCTGGCCAGGCTACGTGCGCCCCCTGCCCCCCGCCGCCATCGAGAGCCCCGCAGTGGCCGCGCCCGCCTACAGCCGCGCGCTCAGCCGGCAACTCAGCAGCGGGGTCTCGGAGATCCGGCACACTGCGGACCGCTGGCGCGTGTCCCTGGATGTCAACCACTTCGCCCCGGACGAGCTGACGGTCAAGACCAAGGATGGCGTGGTGGAGATCACCGGCAAGCACGAGGAGCGGCAGGACGAGCATGGCTACATCTCCCGGTGCTTCACGCGGAAATACACGCTGCCCCCCGGTGTGGACCCCACCCAAGTTTCCTCCTCCCTGTCCCCTGAGGGCACACTGACCGTGGAGGCCCCCATGCCCAAGCTAGCCACGCAGTCCAACGAGATCACCATCCCAGTCACCTTCGAGTCGCGGGCCCAGCTTGGGGGCCCAGAAGCTGCAAAATCCGATGAGACTGCCGCCAAGTAA
ORF Protein Sequence MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T39921-Ab Anti-HSPB1/ HSP20/ CMT2F monoclonal antibody
    Target Antigen GM-Tg-g-T39921-Ag HSP20/HSPB1 VLP (virus-like particle)
    ORF Viral Vector pGMLV000322 Human HSPB1 Lentivirus plasmid
    ORF Viral Vector pGMLV000837 Human HSPB1 Lentivirus plasmid
    ORF Viral Vector pGMLV001124 Human HSPB1 Lentivirus plasmid
    ORF Viral Vector pGMAD001513 Human HSPB1 Adenovirus plasmid
    ORF Viral Vector vGMLV000322 Human HSPB1 Lentivirus particle
    ORF Viral Vector vGMLV000837 Human HSPB1 Lentivirus particle
    ORF Viral Vector vGMLV001124 Human HSPB1 Lentivirus particle
    ORF Viral Vector vGMAD001513 Human HSPB1 Adenovirus particle


    Target information

    Target ID GM-T39921
    Target Name HSP27/HSPB1/HSP20
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3315
    Gene ID 100059763 (Equus caballus), 101084411 (Felis catus), 15507 (Mus musculus), 24471 (Rattus norvegicus)
    3315 (Homo sapiens), 403979 (Canis lupus familiaris), 516099 (Bos taurus), 715615 (Macaca mulatta)
    Gene Symbols & Synonyms HSPB1,Hspb1,27kDa,Hsp25,Hsp27,CMT2F,HMN2B,HMND3,HSP27,HSP28,SRP27,HS.76067,HEL-S-102,HSP 27
    Target Alternative Names HSP27, HSPB1, HSP20,Heat shock protein beta-1,HspB1,28 kDa heat shock protein, Estrogen-regulated 24 kDa protein, Heat shock 27 kDa protein (HSP 27), Heat shock protein family B member 1, Stress-responsive protein 27 (SRP27),CMT2F,HMN2B,HMND3,HSP27,HSP28,Hsp25,SRP27,HS.76067,HEL-S-102
    Uniprot Accession P04792,P14602,P42929,P42930,Q3T149
    Additional SwissProt Accessions: P14602,P42930,P04792,P42929,Q3T149
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease cancer, Prostate Cancer, Congenital occlusion of ureteropelvic junction, Renal clear cell carcinoma
    Disease from KEGG MAPK signaling pathway, Amoebiasis
    Gene Ensembl ENSECAG00000020463, ENSMUSG00000004951, ENSG00000106211, ENSCAFG00845004436, ENSBTAG00000011969, ENSMMUG00000056744
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.