Human CLEC2B/AICL/CLECSF2 ORF/cDNA clone-Lentivirus plasmid (NM_005127)

Cat. No.: pGMLV000976
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CLEC2B/AICL/CLECSF2 Lentiviral expression plasmid for CLEC2B lentivirus packaging, CLEC2B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CLEC2B/AICL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000976
Gene Name CLEC2B
Accession Number NM_005127
Gene ID 9976
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 450 bp
Gene Alias AICL,CLECSF2,HP10085,IFNRG1
Fluorescent Reporter mCherry
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATGACCAAACATAAAAAGTGTTTTATAATTGTTGGTGTTTTAATAACAACTAATATTATTACTCTGATAGTTAAACTAACTCGAGATTCTCAGAGTTTATGCCCCTATGATTGGATTGGTTTCCAAAACAAATGCTATTATTTCTCTAAAGAAGAAGGAGATTGGAATTCAAGTAAATACAACTGTTCCACTCAACATGCCGACCTAACTATAATTGACAACATAGAAGAAATGAATTTTCTTAGGCGGTATAAATGCAGTTCTGATCACTGGATTGGACTGAAGATGGCAAAAAATCGAACAGGACAATGGGTAGATGGAGCTACATTTACCAAATCGTTTGGCATGAGAGGGAGTGAAGGATGTGCCTACCTCAGCGATGATGGTGCAGCAACAGCTAGATGTTACACCGAAAGAAAATGGATTTGCAGGAAAAGAATACACTAA
ORF Protein Sequence MMTKHKKCFIIVGVLITTNIITLIVKLTRDSQSLCPYDWIGFQNKCYYFSKEEGDWNSSKYNCSTQHADLTIIDNIEEMNFLRRYKCSSDHWIGLKMAKNRTGQWVDGATFTKSFGMRGSEGCAYLSDDGAATARCYTERKWICRKRIH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0294-Ab Anti-CLC2B/ CLEC2B/ AICL monoclonal antibody
    Target Antigen GM-Tg-g-MP0294-Ag CLEC2B VLP (virus-like particle)
    ORF Viral Vector pGMLV000976 Human CLEC2B Lentivirus plasmid
    ORF Viral Vector vGMLV000976 Human CLEC2B Lentivirus particle


    Target information

    Target ID GM-MP0294
    Target Name CLEC2B
    Gene Group Identifier
    (Target Gene ID in Homo species)
    9976
    Gene ID 100629907 (Equus caballus), 101084719 (Felis catus), 611423 (Canis lupus familiaris), 717347 (Macaca mulatta)
    9976 (Homo sapiens)
    Gene Symbols & Synonyms CLEC2B,AICL,IFNRG1,CLECSF2,HP10085
    Target Alternative Names AICL,Activation-induced C-type lectin,C-type lectin domain family 2 member B,C-type lectin superfamily member 2,CLEC2B,CLECSF2,HP10085,IFN-alpha-2b-inducing-related protein 1,IFNRG1
    Uniprot Accession Q92478
    Additional SwissProt Accessions: Q92478
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Kaposi sarcoma-associated herpesvirus infection
    Gene Ensembl ENSECAG00000000382, ENSCAFG00845027681, ENSMMUG00000056557, ENSG00000110852
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.