Human RHOA/ARH12/ARHA ORF/cDNA clone-Lentivirus plasmid (NM_001664.4)
Cat. No.: pGMLV000967
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human RHOA/ARH12/ARHA Lentiviral expression plasmid for RHOA lentivirus packaging, RHOA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
RHOA/ARH12 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV000967 |
| Gene Name | RHOA |
| Accession Number | NM_001664.4 |
| Gene ID | 387 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 582 bp |
| Gene Alias | ARH12,ARHA,EDFAOB,RHO12,RHOH12 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCTGCCATCCGGAAGAAACTGGTGATTGTTGGTGATGGAGCCTGTGGAAAGACATGCTTGCTCATAGTCTTCAGCAAGGACCAGTTCCCAGAGGTGTATGTGCCCACAGTGTTTGAGAACTATGTGGCAGATATCGAGGTGGATGGAAAGCAGGTAGAGTTGGCTTTGTGGGACACAGCTGGGCAGGAAGATTATGATCGCCTGAGGCCCCTCTCCTACCCAGATACCGATGTTATACTGATGTGTTTTTCCATCGACAGCCCTGATAGTTTAGAAAACATCCCAGAAAAGTGGACCCCAGAAGTCAAGCATTTCTGTCCCAACGTGCCCATCATCCTGGTTGGGAATAAGAAGGATCTTCGGAATGATGAGCACACAAGGCGGGAGCTAGCCAAGATGAAGCAGGAGCCGGTGAAACCTGAAGAAGGCAGAGATATGGCAAACAGGATTGGCGCTTTTGGGTACATGGAGTGTTCAGCAAAGACCAAAGATGGAGTGAGAGAGGTTTTTGAAATGGCTACGAGAGCTGCTCTGCAAGCTAGACGTGGGAAGAAAAAATCTGGGTGCCTTGTCTTGTGA |
| ORF Protein Sequence | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T96736-Ab | Anti-RHOA/ ARH12/ ARHA monoclonal antibody |
| Target Antigen | GM-Tg-g-T96736-Ag | RHOA VLP (virus-like particle) |
| ORF Viral Vector | pGMLP005662 | Human RHOA Lentivirus plasmid |
| ORF Viral Vector | pGMLV000967 | Human RHOA Lentivirus plasmid |
| ORF Viral Vector | pGMLV001080 | Human RHOA Lentivirus plasmid |
| ORF Viral Vector | pGMLV001496 | Human RHOA Lentivirus plasmid |
| ORF Viral Vector | pGMAP000445 | Human RHOA Adenovirus plasmid |
| ORF Viral Vector | pGMAP000543 | Human RHOA Adenovirus plasmid |
| ORF Viral Vector | pGMLP-SPh-067 | Human RHOA Lentivirus plasmid |
| ORF Viral Vector | pGMAP-SPh-207 | Human RHOA Adenovirus plasmid |
| ORF Viral Vector | pGMPC000595 | Human RHOA Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | pGMPC001816 | Human RHOA Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP005662 | Human RHOA Lentivirus particle |
| ORF Viral Vector | vGMLV000967 | Human RHOA Lentivirus particle |
| ORF Viral Vector | vGMLV001080 | Human RHOA Lentivirus particle |
| ORF Viral Vector | vGMLV001496 | Human RHOA Lentivirus particle |
| ORF Viral Vector | vGMAP000445 | Human RHOA Adenovirus particle |
| ORF Viral Vector | vGMAP000543 | Human RHOA Adenovirus particle |
| ORF Viral Vector | vGMLP-SPh-067 | Human RHOA Lentivirus particle |
| ORF Viral Vector | vGMAP-SPh-207 | Human RHOA Adenovirus particle |
Target information
| Target ID | GM-T96736 |
| Target Name | RHOA |
|
Gene Group Identifier (Target Gene ID in Homo species) |
387 |
| Gene ID |
100053343 (Equus caballus), 101084011 (Felis catus), 117273 (Rattus norvegicus), 11848 (Mus musculus) 338049 (Bos taurus), 387 (Homo sapiens), 403954 (Canis lupus familiaris), 706455 (Macaca mulatta) |
| Gene Symbols & Synonyms | RHOA,Rhoa,Arha,Arha2,Arha1,ARHA,ARH12,RHO12,EDFAOB,RHOH12,RHO1 |
| Target Alternative Names | ARH12,ARHA,Arha,Arha1,Arha2,EDFAOB,RHO1,RHO12,RHOA,RHOH12,Rho cDNA clone 12 (h12),Rhoa,Transforming protein RhoA |
| Uniprot Accession |
P24406,P61585,P61586,P61589,Q9QUI0
Additional SwissProt Accessions: P61589,Q9QUI0,P61585,P61586,P24406 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | cancer, Breast Cancer |
| Disease from KEGG | Ras signaling pathway, Rap1 signaling pathway, cGMP-PKG signaling pathway, cAMP signaling pathway, Chemokine signaling pathway, Sphingolipid signaling pathway, Phospholipase D signaling pathway, Vascular smooth muscle contraction, Wnt signaling pathway, TGF-beta signaling pathway, Axon guidance, Focal adhesion, Adherens junction, Tight junction, Platelet activation, NOD-like receptor signaling pathway, C-type lectin receptor signaling pathway, T cell receptor signaling pathway, Leukocyte transendothelial migration, Neurotrophin signaling pathway, Regulation of actin cytoskeleton, Oxytocin signaling pathway, Parathyroid hormone synthesis, secretion and action, Pancreatic secretion, Pathogenic Escherichia coli infection, Pertussis, Yersinia infection, Tuberculosis, Human cytomegalovirus infection, Pathways in cancer, Proteoglycans in cancer, Colorectal cancer, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSECAG00000033791, ENSMUSG00000007815, ENSBTAG00000004279, ENSG00000067560, ENSCAFG00845026916, ENSMMUG00000047476 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


