Human UBE2D3/E2(17)KB3/UBC4/5 ORF/cDNA clone-Lentivirus plasmid (NM_181891.3)

Cat. No.: pGMLV000898
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human UBE2D3/E2(17)KB3/UBC4/5 Lentiviral expression plasmid for UBE2D3 lentivirus packaging, UBE2D3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to UBE2D3/E2(17)KB3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000898
Gene Name UBE2D3
Accession Number NM_181891.3
Gene ID 7323
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 444 bp
Gene Alias E2(17)KB3,UBC4/5,UBCH5C
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGCTGAAACGGATTAATAAGGAACTTAGTGATTTGGCCCGTGACCCTCCAGCACAATGTTCTGCAGGTCCAGTTGGGGATGATATGTTTCATTGGCAAGCCACAATTATGGGACCTAATGACAGCCCATATCAAGGCGGTGTATTCTTTTTGACAATTCATTTTCCTACAGACTACCCCTTCAAACCACCTAAGGTTGCATTTACAACAAGAATTTATCATCCAAATATTAACAGTAATGGCAGCATTTGTCTCGATATTCTAAGATCACAGTGGTCGCCTGCTTTAACAATTTCTAAAGTTCTTTTATCCATTTGTTCACTGCTATGTGATCCAAACCCAGATGACCCCCTAGTGCCAGAGATTGCACGGATCTATAAAACAGACAGAGATAAGTACAACAGAATATCTCGGGAATGGACTCAGAAGTATGCCATGTGA
ORF Protein Sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2373-Ab Anti-UB2D3/ UBE2D3/ E2(17)KB3 monoclonal antibody
    Target Antigen GM-Tg-g-MP2373-Ag UBE2D3 VLP (virus-like particle)
    ORF Viral Vector pGMLV000898 Human UBE2D3 Lentivirus plasmid
    ORF Viral Vector pGMAD000155 Human UBE2D3 Adenovirus plasmid
    ORF Viral Vector vGMLV000898 Human UBE2D3 Lentivirus particle
    ORF Viral Vector vGMAD000155 Human UBE2D3 Adenovirus particle


    Target information

    Target ID GM-MP2373
    Target Name UBE2D3
    Gene Group Identifier
    (Target Gene ID in Homo species)
    7323
    Gene ID 100630481 (Equus caballus), 101094845 (Felis catus), 326583 (Bos taurus), 478495 (Canis lupus familiaris)
    66105 (Mus musculus), 710772 (Macaca mulatta), 7323 (Homo sapiens), 81920 (Rattus norvegicus)
    Gene Symbols & Synonyms UBE2D3,Ube2d3,UBE2D3P,1100001F19Rik,9430029A22Rik,UBC4/5,UBCH5C,E2(17)KB3
    Target Alternative Names (E3-independent) E2 ubiquitin-conjugating enzyme D3,1100001F19Rik,9430029A22Rik,E2 ubiquitin-conjugating enzyme D3,E2(17)KB3,UBC4/5,UBCH5C,UBE2D3,UBE2D3P,Ube2d3,Ubiquitin carrier protein D3,Ubiquitin-conjugating enzyme E2 D3,Ubiquitin-conjugating enzyme E2(17)KB 3,Ubiquitin-conjugating enzyme E2-17 kDa 3,Ubiquitin-protein ligase D3
    Uniprot Accession P61077,P61078,P61079,Q3ZCF7
    Additional SwissProt Accessions: Q3ZCF7,P61079,P61077,P61078
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG Protein processing in endoplasmic reticulum
    Gene Ensembl ENSECAG00000020678, ENSBTAG00000048761, ENSCAFG00845026289, ENSMUSG00000078578, ENSMMUG00000011201, ENSG00000109332
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.