Human HLA-DQB1/CELIAC1/HLA-DQB ORF/cDNA clone-Lentivirus plasmid (NM_001243961.1)

Cat. No.: pGMLV000874
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HLA-DQB1/CELIAC1/HLA-DQB Lentiviral expression plasmid for HLA-DQB1 lentivirus packaging, HLA-DQB1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to HLA-DQB1/CELIAC1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $502.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000874
Gene Name HLA-DQB1
Accession Number NM_001243961.1
Gene ID 3119
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 810 bp
Gene Alias CELIAC1,HLA-DQB,IDDM1
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTTGGAAGAAGGCTTTGCGGATCCCCGGAGACCTTCGGGTAGCAACTGTCACCTTGATGCTGGCGATGCTGAGCTCCCTACTGGCTGAGGGCAGAGACTCTCCCGAGGATTTCGTGTTCCAGTTTAAGGGCATGTGCTACTTCACCAACGGGACGGAGCGCGTGCGTCTTGTGACCAGATACATCTATAACCGAGAGGAGTACGCGCGCTTCGACAGCGACGTGGGGGTGTACCGCGCGGTGACGCCGCAGGGGCGGCCTGATGCCGAGTACTGGAACAGCCAGAAGGAAGTCCTGGAGGGGACCCGGGCGGAGTTGGACACGGTGTGCAGACACAACTACGAGGTGGCGTTCCGCGGGATCTTGCAGAGGAGAGTGGAGCCCACAGTGACCATCTCCCCATCCAGGACAGAGGCCCTCAACCACCACAACCTGCTGGTCTGCTCGGTGACAGATTTCTATCCAGGCCAGATCAAAGTCCGGTGGTTTCGGAATGATCAGGAGGAGACAGCCGGCGTTGTGTCCACCCCCCTTATTAGGAATGGTGACTGGACTTTCCAGATCCTGGTGATGCTGGAAATGACTCCCCAGCGTGGAGATGTCTACACCTGCCACGTGGAGCACCCCAGCCTCCAGAGCCCCATCACCGTGGAGTGGCGGGCTCAGTCTGAATCTGCCCAGAGCAAGATGCTGAGTGGCGTTGGAGGCTTCGTGCTGGGGCTGATCTTCCTTGGGCTGGGCCTTATCATCCGTCAAAGGAGTCAGAAAGGACCTCAAGGGCCTCCACCAGCAGGGCTTCTGCACTGA
ORF Protein Sequence MSWKKALRIPGDLRVATVTLMLAMLSSLLAEGRDSPEDFVFQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQGRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFRGILQRRVEPTVTISPSRTEALNHHNLLVCSVTDFYPGQIKVRWFRNDQEETAGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQSPITVEWRAQSESAQSKMLSGVGGFVLGLIFLGLGLIIRQRSQKGPQGPPPAGLLH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0586-Ab Anti-DQB1/ HLA-DQB1/ CELIAC1 monoclonal antibody
    Target Antigen GM-Tg-g-MP0586-Ag HLA-DQB1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002641 Human HLA-DQB1 Lentivirus plasmid
    ORF Viral Vector pGMLV000874 Human HLA-DQB1 Lentivirus plasmid
    ORF Viral Vector vGMLP002641 Human HLA-DQB1 Lentivirus particle
    ORF Viral Vector vGMLV000874 Human HLA-DQB1 Lentivirus particle


    Target information

    Target ID GM-MP0586
    Target Name HLA-DQB1
    Gene Group Identifier
    （Target Gene ID in Homo species)         		3119
    Gene ID 3119 (Homo sapiens), 474862 (Canis lupus familiaris)
    Gene Symbols & Synonyms HLA-DQB1,DLA-DQB1,IDDM1,CELIAC1,HLA-DQB,DQB,DLA-DQB,DLA-DQBC1
    Target Alternative Names CELIAC1,DLA-DQB,DLA-DQB1,DLA-DQBC1,DQ beta 1 chain,DQB,HLA class II histocompatibility antigen,HLA-DQB,HLA-DQB1,IDDM1,MHC class II antigen DQB1
    Uniprot Accession P01920
    Additional SwissProt Accessions: P01920
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG Phagosome, Cell adhesion molecules, Antigen processing and presentation, Hematopoietic cell lineage, Th1 and Th2 cell differentiation, Th17 cell differentiation, Intestinal immune network for IgA production, Type I diabetes mellitus, Leishmaniasis, Toxoplasmosis, Staphylococcus aureus infection, Tuberculosis, Influenza A, Human T-cell leukemia virus 1 infection, Epstein-Barr virus infection, Asthma, Autoimmune thyroid disease, Inflammatory bowel disease, Rheumatoid arthritis, Allograft rejection, Graft-versus-host disease, Viral myocarditis
    Gene Ensembl ENSG00000179344
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.