Human MAPK1/ERK/ERK-2 ORF/cDNA clone-Lentivirus plasmid (NM_002745.4)
Cat. No.: pGMLV000835
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human MAPK1/ERK/ERK-2 Lentiviral expression plasmid for MAPK1 lentivirus packaging, MAPK1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
MAPK1/ERK2/MAPK1/ERK products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV000835 |
| Gene Name | MAPK1 |
| Accession Number | NM_002745.4 |
| Gene ID | 5594 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 1083 bp |
| Gene Alias | ERK,ERK-2,ERK2,ERT1,MAPK2,p38,p40,p41,p41mapk,p42-MAPK,P42MAPK,PRKM1,PRKM2 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | Null |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGGCGGCGGCGGCGGCGGGCGCGGGCCCGGAGATGGTCCGCGGGCAGGTGTTCGACGTGGGGCCGCGCTACACCAACCTCTCGTACATCGGCGAGGGCGCCTACGGCATGGTGTGCTCTGCTTATGATAATGTCAACAAAGTTCGAGTAGCTATCAAGAAAATCAGCCCCTTTGAGCACCAGACCTACTGCCAGAGAACCCTGAGGGAGATAAAAATCTTACTGCGCTTCAGACATGAGAACATCATTGGAATCAATGACATTATTCGAGCACCAACCATCGAGCAAATGAAAGATGTATATATAGTACAGGACCTCATGGAAACAGATCTTTACAAGCTCTTGAAGACACAACACCTCAGCAATGACCATATCTGCTATTTTCTCTACCAGATCCTCAGAGGGTTAAAATATATCCATTCAGCTAACGTTCTGCACCGTGACCTCAAGCCTTCCAACCTGCTGCTCAACACCACCTGTGATCTCAAGATCTGTGACTTTGGCCTGGCCCGTGTTGCAGATCCAGACCATGATCACACAGGGTTCCTGACAGAATATGTGGCCACACGTTGGTACAGGGCTCCAGAAATTATGTTGAATTCCAAGGGCTACACCAAGTCCATTGATATTTGGTCTGTAGGCTGCATTCTGGCAGAAATGCTTTCTAACAGGCCCATCTTTCCAGGGAAGCATTATCTTGACCAGCTGAACCACATTTTGGGTATTCTTGGATCCCCATCACAAGAAGACCTGAATTGTATAATAAATTTAAAAGCTAGGAACTATTTGCTTTCTCTTCCACACAAAAATAAGGTGCCATGGAACAGGCTGTTCCCAAATGCTGACTCCAAAGCTCTGGACTTATTGGACAAAATGTTGACATTCAACCCACACAAGAGGATTGAAGTAGAACAGGCTCTGGCCCACCCATATCTGGAGCAGTATTACGACCCGAGTGACGAGCCCATCGCCGAAGCACCATTCAAGTTCGACATGGAATTGGATGACTTGCCTAAGGAAAAGCTCAAAGAACTAATTTTTGAAGAGACTGCTAGATTCCAGCCAGGATACAGATCTTAA |
| ORF Protein Sequence | MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T58970-Ab | Anti-ERK2 monoclonal antibody |
| Target Antigen | GM-Tg-g-T58970-Ag | ERK2/MAPK1 protein |
| ORF Viral Vector | pGMLP005532 | Human MAPK1 Lentivirus plasmid |
| ORF Viral Vector | pGMLP005592 | Human MAPK1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000835 | Human MAPK1 Lentivirus plasmid |
| ORF Viral Vector | pGMLP-SPh-055 | Human MAPK1 Lentivirus plasmid |
| ORF Viral Vector | pGMAP-SPh-195 | Human MAPK1 Adenovirus plasmid |
| ORF Viral Vector | pGMPC000321 | Human MAPK1 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP005532 | Human MAPK1 Lentivirus particle |
| ORF Viral Vector | vGMLP005592 | Human MAPK1 Lentivirus particle |
| ORF Viral Vector | vGMLV000835 | Human MAPK1 Lentivirus particle |
| ORF Viral Vector | vGMLP-SPh-055 | Human MAPK1 Lentivirus particle |
| ORF Viral Vector | vGMAP-SPh-195 | Human MAPK1 Adenovirus particle |
Target information
| Target ID | GM-T58970 |
| Target Name | MAPK1/ERK2 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
5594 |
| Gene ID |
100057701 (Equus caballus), 101087614 (Felis catus), 116590 (Rattus norvegicus), 26413 (Mus musculus) 327672 (Bos taurus), 477575 (Canis lupus familiaris), 5594 (Homo sapiens), 698569 (Macaca mulatta) |
| Gene Symbols & Synonyms | MAPK1,Mapk1,ERT1,Erk2,ERK-2,p42-MAPK,ERK,MAPK2,PRKM2,Prkm1,p41mapk,p42mapk,9030612K14Rik,ERK2,p38,p40,p41,NS13,PRKM1,P42MAPK |
| Target Alternative Names | 9030612K14Rik,ERK,ERK-2,ERK2,ERT1,Erk2,Extracellular signal-regulated kinase 2 (ERK-2),MAP kinase 1,MAP kinase isoform p42 (p42-MAPK),MAPK 1,MAPK 2),MAPK1,MAPK2,Mapk1,Mitogen-activated protein kinase 1,Mitogen-activated protein kinase 2 (MAP kinase 2,NS13,P42MAPK,PRKM1,PRKM2,Prkm1,p38,p40,p41,p41mapk,p42-MAPK,p42mapk |
| Uniprot Accession |
P28482,P46196,P63085,P63086
Additional SwissProt Accessions: P63086,P63085,P46196,P28482 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer |
| Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, Endocrine resistance, MAPK signaling pathway, ErbB signaling pathway, Ras signaling pathway, Rap1 signaling pathway, cGMP-PKG signaling pathway, cAMP signaling pathway, Chemokine signaling pathway, HIF-1 signaling pathway, FoxO signaling pathway, Sphingolipid signaling pathway, Phospholipase D signaling pathway, PI3K-Akt signaling pathway, Apoptosis, Cellular senescence, Adrenergic signaling in cardiomyocytes, Vascular smooth muscle contraction, TGF-beta signaling pathway, Axon guidance, Osteoclast differentiation, Focal adhesion, Adherens junction, Gap junction, Signaling pathways regulating pluripotency of stem cells, Platelet activation, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, C-type lectin receptor signaling pathway, Natural killer cell mediated cytotoxicity, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, B cell receptor signaling pathway, Fc epsilon RI signaling pathway, TNF signaling pathway, Circadian entrainment, Long-term potentiation, Neurotrophin signaling pathway, Glutamatergic synapse, Cholinergic synapse, Serotonergic synapse, Regulation of actin cytoskeleton, GnRH signaling pathway, Melanogenesis, Prolactin signaling pathway, Thyroid hormone signaling pathway, Oxytocin signaling pathway, Relaxin signaling pathway, Parathyroid hormone synthesis, secretion and action, GnRH secretion, Type II diabetes mellitus, AGE-RAGE signaling pathway in diabetic complications, Cushing syndrome, Growth hormone synthesis, secretion and action, Aldosterone-regulated sodium reabsorption, Alzheimer disease, Pathogenic Escherichia coli infection, Pertussis, Yersinia infection, Leishmaniasis, Chagas disease, Toxoplasmosis, Tuberculosis, Hepatitis C, Hepatitis B, Human cytomegalovirus infection, Influenza A, Human papillomavirus infection, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Proteoglycans in cancer, Chemical carcinogenesis - receptor activation, Colorectal cancer, Renal cell carcinoma, Pancreatic cancer, Endometrial cancer, Glioma, Prostate cancer, Thyroid cancer, Melanoma, Bladder cancer, Chronic myeloid leukemia, Acute myeloid leukemia, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma, Gastric cancer, Central carbon metabolism in cancer, Choline metabolism in cancer, PD-L1 expression and PD-1 checkpoint pathway in cancer, Lipid and atherosclerosis |
| Gene Ensembl | ENSECAG00000010551, ENSMUSG00000063358, ENSBTAG00000010312, ENSCAFG00845026389, ENSG00000100030, ENSMMUG00000012524 |
| Target Classification | Kinase, Tumor-associated antigen (TAA) |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


