Human GFER/ALR/ERV1 ORF/cDNA clone-Lentivirus plasmid (NM_005262.2)

Cat. No.: pGMLV000509
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human GFER/ALR/ERV1 Lentiviral expression plasmid for GFER lentivirus packaging, GFER lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ALR/GFER/GFER/ALR products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $454.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000509
Gene Name GFER
Accession Number NM_005262.2
Gene ID 2671
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 618 bp
Gene Alias ALR,ERV1,HERV1,HPO,HPO1,HPO2,HSS
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGCCCGGCGAGCGGGGCCGCTTCCACGGCGGGAACCTCTTCTTCCTGCCGGGGGGCGCGCGCTCCGAGATGATGGACGACCTGGCGACCGACGCGCGGGGCCGGGGCGCGGGGCGGAGAGACGCGGCCGCCTCGGCCTCGACGCCAGCCCAGGCGCCGACCTCCGATTCTCCTGTCGCCGAGGACGCCTCCCGGAGGCGGCCGTGCCGGGCCTGCGTCGACTTCAAGACGTGGATGCGGACGCAGCAGAAGCGGGACACCAAGTTTAGGGAGGACTGCCCGCCGGATCGCGAGGAACTGGGCCGCCACAGCTGGGCTGTCCTCCACACCCTGGCCGCCTACTACCCCGACCTGCCCACCCCAGAACAGCAGCAAGACATGGCCCAGTTCATACATTTATTTTCTAAGTTTTACCCCTGTGAGGAGTGTGCTGAAGACCTAAGAAAAAGGCTGTGCAGGAACCACCCAGACACCCGCACCCGGGCATGCTTCACACAGTGGCTGTGCCACCTGCACAATGAAGTGAACCGCAAGCTGGGCAAGCCTGACTTCGACTGCTCAAAAGTGGATGAGCGCTGGCGCGACGGCTGGAAGGATGGCTCCTGTGACTAG
ORF Protein Sequence MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRPCRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0943-Ab Anti-ALR/ GFER/ ERV1 functional antibody
    Target Antigen GM-Tg-g-SE0943-Ag GFER protein
    ORF Viral Vector pGMLP003164 Human GFER Lentivirus plasmid
    ORF Viral Vector pGMLV000509 Human GFER Lentivirus plasmid
    ORF Viral Vector vGMLP003164 Human GFER Lentivirus particle
    ORF Viral Vector vGMLV000509 Human GFER Lentivirus particle


    Target information

    Target ID GM-SE0943
    Target Name ALR/GFER
    Gene Group Identifier
    (Target Gene ID in Homo species)
    2671
    Gene ID 100065617 (Equus caballus), 101082968 (Felis catus), 11692 (Mus musculus), 2671 (Homo sapiens)
    27100 (Rattus norvegicus), 479885 (Canis lupus familiaris), 618423 (Bos taurus), 694203 (Macaca mulatta)
    Gene Symbols & Synonyms GFER,Gfer,Alr,ERV1,ALR,HPO,HSS,HPO1,HPO2,HERV1,MMCHD,MPMCD
    Target Alternative Names ALR,Alr,Augmenter of liver regeneration (hERV1),ERV1,FAD-linked sulfhydryl oxidase ALR,GFER,Gfer,HERV1,HPO,HPO1,HPO2,HSS,Hepatopoietin,MMCHD,MPMCD
    Uniprot Accession P55789,P56213,Q63042
    Additional SwissProt Accessions: P56213,P55789,Q63042
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSMUSG00000040888, ENSG00000127554, ENSMMUG00000052399
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.