Human HGF/DFNB39/F-TCF ORF/cDNA clone-Lentivirus plasmid (NM_001010934.2)
Cat. No.: pGMLV000432
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human HGF/DFNB39/F-TCF Lentiviral expression plasmid for HGF lentivirus packaging, HGF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
HGF/DFNB39 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV000432 |
Gene Name | HGF |
Accession Number | NM_001010934.2 |
Gene ID | 3082 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 633 bp |
Gene Alias | DFNB39,F-TCF,HGFB,HPTA,SF |
Fluorescent Reporter | mCherry |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | Null |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTGGGTGACCAAACTCCTGCCAGCCCTGCTGCTGCAGCATGTCCTCCTGCATCTCCTCCTGCTCCCCATCGCCATCCCCTATGCAGAGGGACAAAGGAAAAGAAGAAATACAATTCATGAATTCAAAAAATCAGCAAAGACTACCCTAATCAAAATAGATCCAGCACTGAAGATAAAAACCAAAAAAGTGAATACTGCAGACCAATGTGCTAATAGATGTACTAGGAATAAAGGACTTCCATTCACTTGCAAGGCTTTTGTTTTTGATAAAGCAAGAAAACAATGCCTCTGGTTCCCCTTCAATAGCATGTCAAGTGGAGTGAAAAAAGAATTTGGCCATGAATTTGACCTCTATGAAAACAAAGACTACATTAGAAACTGCATCATTGGTAAAGGACGCAGCTACAAGGGAACAGTATCTATCACTAAGAGTGGCATCAAATGTCAGCCCTGGAGTTCCATGATACCACACGAACACAGCTTTTTGCCTTCGAGCTATCGGGGTAAAGACCTACAGGAAAACTACTGTCGAAATCCTCGAGGGGAAGAAGGGGGACCCTGGTGTTTCACAAGCAATCCAGAGGTACGCTACGAAGTCTGTGACATTCCTCAGTGTTCAGAAGGTAAATAA |
ORF Protein Sequence | MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEGK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-ab-212 | Pre-Made Ficlatuzumab biosimilar, Whole mAb, Anti-HGF Antibody: Anti-DFNB39/F-TCF/HPTA/SF therapeutic antibody |
Biosimilar | GMP-Bios-ab-483 | Pre-Made Rilotumumab biosimilar, Whole mAb, Anti-HGF Antibody: Anti-DFNB39/F-TCF/HPTA/SF therapeutic antibody |
Target Antibody | GM-Tg-g-T83797-Ab | Anti-HGF/ DFNB39/ F-TCFB functional antibody |
Target Antigen | GM-Tg-g-T83797-Ag | HGF protein |
Cytokine | cks-Tg-g-GM-T83797 | hepatocyte growth factor (HGF) protein & antibody |
ORF Viral Vector | pGMLV000432 | Human HGF Lentivirus plasmid |
ORF Viral Vector | pGMLV000683 | Human HGF Lentivirus plasmid |
ORF Viral Vector | pGMLV001824 | Human HGF Lentivirus plasmid |
ORF Viral Vector | vGMLV000432 | Human HGF Lentivirus particle |
ORF Viral Vector | vGMLV000683 | Human HGF Lentivirus particle |
ORF Viral Vector | vGMLV001824 | Human HGF Lentivirus particle |
Target information
Target ID | GM-T83797 |
Target Name | HGF |
Gene Group Identifier (Target Gene ID in Homo species) |
3082 |
Gene ID |
100049848 (Equus caballus), 15234 (Mus musculus), 24446 (Rattus norvegicus), 282879 (Bos taurus) 3082 (Homo sapiens), 403441 (Canis lupus familiaris), 493705 (Felis catus), 708316 (Macaca mulatta) |
Gene Symbols & Synonyms | HGF,Hgf,SF,NK1,NK2,HGF/SF,SF/HGF,C230052L06Rik,HPTA,HGFB,F-TCF,DFNB39 |
Target Alternative Names | HGF,Hepatocyte growth factor,Hepatopoietin-A, Scatter factor (SF),SF,HGFB,HPTA,F-TCF,DFNB39 |
Uniprot Accession |
P14210,P17945,Q08048,Q76BS1,Q867B7,Q9BH09
Additional SwissProt Accessions: Q08048,P17945,Q76BS1,P14210,Q867B7,Q9BH09 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target |
Disease | cancer, Liver Cancer, breast cancer |
Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Focal adhesion, Malaria, Pathways in cancer, Proteoglycans in cancer, Renal cell carcinoma, Melanoma, Non-small cell lung cancer, Hepatocellular carcinoma, Gastric cancer |
Gene Ensembl | ENSECAG00000011223, ENSMUSG00000028864, ENSBTAG00000017664, ENSG00000019991, ENSCAFG00845025968, ENSMMUG00000018652 |
Target Classification | Checkpoint-Immuno Oncology |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.