Human HGF/DFNB39/F-TCF ORF/cDNA clone-Lentivirus plasmid (NM_001010934.2)

Cat. No.: pGMLV000432
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HGF/DFNB39/F-TCF Lentiviral expression plasmid for HGF lentivirus packaging, HGF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to HGF/DFNB39 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $458.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000432
Gene Name HGF
Accession Number NM_001010934.2
Gene ID 3082
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 633 bp
Gene Alias DFNB39,F-TCF,HGFB,HPTA,SF
Fluorescent Reporter mCherry
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGGTGACCAAACTCCTGCCAGCCCTGCTGCTGCAGCATGTCCTCCTGCATCTCCTCCTGCTCCCCATCGCCATCCCCTATGCAGAGGGACAAAGGAAAAGAAGAAATACAATTCATGAATTCAAAAAATCAGCAAAGACTACCCTAATCAAAATAGATCCAGCACTGAAGATAAAAACCAAAAAAGTGAATACTGCAGACCAATGTGCTAATAGATGTACTAGGAATAAAGGACTTCCATTCACTTGCAAGGCTTTTGTTTTTGATAAAGCAAGAAAACAATGCCTCTGGTTCCCCTTCAATAGCATGTCAAGTGGAGTGAAAAAAGAATTTGGCCATGAATTTGACCTCTATGAAAACAAAGACTACATTAGAAACTGCATCATTGGTAAAGGACGCAGCTACAAGGGAACAGTATCTATCACTAAGAGTGGCATCAAATGTCAGCCCTGGAGTTCCATGATACCACACGAACACAGCTTTTTGCCTTCGAGCTATCGGGGTAAAGACCTACAGGAAAACTACTGTCGAAATCCTCGAGGGGAAGAAGGGGGACCCTGGTGTTTCACAAGCAATCCAGAGGTACGCTACGAAGTCTGTGACATTCCTCAGTGTTCAGAAGGTAAATAA
ORF Protein Sequence MWVTKLLPALLLQHVLLHLLLLPIAIPYAEGQRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEGK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-212 Pre-Made Ficlatuzumab biosimilar, Whole mAb, Anti-HGF Antibody: Anti-DFNB39/F-TCF/HPTA/SF therapeutic antibody
    Biosimilar GMP-Bios-ab-483 Pre-Made Rilotumumab biosimilar, Whole mAb, Anti-HGF Antibody: Anti-DFNB39/F-TCF/HPTA/SF therapeutic antibody
    Target Antibody GM-Tg-g-T83797-Ab Anti-HGF/ DFNB39/ F-TCFB functional antibody
    Target Antigen GM-Tg-g-T83797-Ag HGF protein
    Cytokine cks-Tg-g-GM-T83797 hepatocyte growth factor (HGF) protein & antibody
    ORF Viral Vector pGMLV000432 Human HGF Lentivirus plasmid
    ORF Viral Vector pGMLV000683 Human HGF Lentivirus plasmid
    ORF Viral Vector pGMLV001824 Human HGF Lentivirus plasmid
    ORF Viral Vector vGMLV000432 Human HGF Lentivirus particle
    ORF Viral Vector vGMLV000683 Human HGF Lentivirus particle
    ORF Viral Vector vGMLV001824 Human HGF Lentivirus particle


    Target information

    Target ID GM-T83797
    Target Name HGF
    Gene Group Identifier
    (Target Gene ID in Homo species)
    3082
    Gene ID 100049848 (Equus caballus), 15234 (Mus musculus), 24446 (Rattus norvegicus), 282879 (Bos taurus)
    3082 (Homo sapiens), 403441 (Canis lupus familiaris), 493705 (Felis catus), 708316 (Macaca mulatta)
    Gene Symbols & Synonyms HGF,Hgf,SF,NK1,NK2,HGF/SF,SF/HGF,C230052L06Rik,HPTA,HGFB,F-TCF,DFNB39
    Target Alternative Names HGF,Hepatocyte growth factor,Hepatopoietin-A, Scatter factor (SF),SF,HGFB,HPTA,F-TCF,DFNB39
    Uniprot Accession P14210,P17945,Q08048,Q76BS1,Q867B7,Q9BH09
    Additional SwissProt Accessions: Q08048,P17945,Q76BS1,P14210,Q867B7,Q9BH09
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target, INN Index, Cytokine Target
    Disease cancer, Liver Cancer, breast cancer
    Disease from KEGG EGFR tyrosine kinase inhibitor resistance, MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, PI3K-Akt signaling pathway, Focal adhesion, Malaria, Pathways in cancer, Proteoglycans in cancer, Renal cell carcinoma, Melanoma, Non-small cell lung cancer, Hepatocellular carcinoma, Gastric cancer
    Gene Ensembl ENSECAG00000011223, ENSMUSG00000028864, ENSBTAG00000017664, ENSG00000019991, ENSCAFG00845025968, ENSMMUG00000018652
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.