Human CTF1/CT-1/CT1 ORF/cDNA clone-Lentivirus plasmid (NM_001330.3)
Cat. No.: pGMLV000332
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CTF1/CT-1/CT1 Lentiviral expression plasmid for CTF1 lentivirus packaging, CTF1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CTF1/CT-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV000332 |
Gene Name | CTF1 |
Accession Number | NM_001330.3 |
Gene ID | 1489 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 606 bp |
Gene Alias | CT-1,CT1 |
Fluorescent Reporter | Null |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | Null |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGCCGGAGGGAGGGAAGTCTGGAAGACCCCCAGACTGATTCCTCAGTCTCACTTCTTCCCCACTTGGAGGCCAAGATCCGTCAGACACACAGCCTTGCGCACCTCCTCACCAAATACGCTGAGCAGCTGCTCCAGGAATATGTGCAGCTCCAGGGAGACCCCTTCGGGCTGCCCAGCTTCTCGCCGCCGCGGCTGCCGGTGGCCGGCCTGAGCGCCCCGGCTCCGAGCCACGCGGGGCTGCCAGTGCACGAGCGGCTGCGGCTGGACGCGGCGGCGCTGGCCGCGCTGCCCCCGCTGCTGGACGCAGTGTGTCGCCGCCAGGCCGAGCTGAACCCGCGCGCGCCGCGCCTGCTGCGCCGCCTGGAGGACGCGGCGCGCCAGGCCCGGGCCCTGGGCGCCGCCGTGGAGGCCTTGCTGGCCGCGCTGGGCGCCGCCAACCGCGGGCCCCGGGCCGAGCCCCCCGCCGCCACCGCCTCAGCCGCCTCCGCCACCGGGGTCTTCCCCGCCAAGGTGCTGGGGCTCCGCGTTTGCGGCCTCTACCGCGAGTGGCTGAGCCGCACCGAGGGCGACCTGGGCCAGCTGCTGCCCGGGGGCTCGGCCTGA |
ORF Protein Sequence | MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T94977-Ab | Anti-CTF1/ CT-1/ CT1 functional antibody |
Target Antigen | GM-Tg-g-T94977-Ag | CTF1 protein |
Cytokine | cks-Tg-g-GM-T94977 | cardiotrophin 1 (CTF1) protein & antibody |
ORF Viral Vector | pGMLP004846 | Human CTF1 Lentivirus plasmid |
ORF Viral Vector | pGMLV000332 | Human CTF1 Lentivirus plasmid |
ORF Viral Vector | vGMLP004846 | Human CTF1 Lentivirus particle |
ORF Viral Vector | vGMLV000332 | Human CTF1 Lentivirus particle |
Target information
Target ID | GM-T94977 |
Target Name | CTF1 |
Gene Group Identifier (Target Gene ID in Homo species) |
1489 |
Gene ID |
13019 (Mus musculus), 1489 (Homo sapiens), 29201 (Rattus norvegicus), 403821 (Canis lupus familiaris) 514803 (Bos taurus), 713850 (Macaca mulatta) |
Gene Symbols & Synonyms | Ctf1,CTF1,CT-1,CT1 |
Target Alternative Names | CTF1,Cardiotrophin-1,CT-1,CT1,CT-1 |
Uniprot Accession |
Q16619,Q60753,Q63086
Additional SwissProt Accessions: Q60753,Q16619,Q63086 |
Uniprot Entry Name | |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, Cytokine Target |
Disease | |
Disease from KEGG | Cytokine-cytokine receptor interaction, JAK-STAT signaling pathway |
Gene Ensembl | ENSMUSG00000042340, ENSG00000150281, ENSCAFG00845013066, ENSBTAG00000017697, ENSMMUG00000047302 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.