Human HSPB1/CMT2F/HEL-S-102 ORF/cDNA clone-Lentivirus plasmid (NM_001540.3)
Cat. No.: pGMLV000322
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human HSPB1/CMT2F/HEL-S-102 Lentiviral expression plasmid for HSPB1 lentivirus packaging, HSPB1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
HSP27/HSPB1/HSP20/HSPB1/CMT2F products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV000322 |
| Gene Name | HSPB1 |
| Accession Number | NM_001540.3 |
| Gene ID | 3315 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 618 bp |
| Gene Alias | CMT2F,HEL-S-102,HMN2B,HS.76067,Hsp25,HSP27,HSP28,SRP27 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGACCGAGCGCCGCGTCCCCTTCTCGCTCCTGCGGGGCCCCAGCTGGGACCCCTTCCGCGACTGGTACCCGCATAGCCGCCTCTTCGACCAGGCCTTCGGGCTGCCCCGGCTGCCGGAGGAGTGGTCGCAGTGGTTAGGCGGCAGCAGCTGGCCAGGCTACGTGCGCCCCCTGCCCCCCGCCGCCATCGAGAGCCCCGCAGTGGCCGCGCCCGCCTACAGCCGCGCGCTCAGCCGGCAACTCAGCAGCGGGGTCTCGGAGATCCGGCACACTGCGGACCGCTGGCGCGTGTCCCTGGATGTCAACCACTTCGCCCCGGACGAGCTGACGGTCAAGACCAAGGATGGCGTGGTGGAGATCACCGGCAAGCACGAGGAGCGGCAGGACGAGCATGGCTACATCTCCCGGTGCTTCACGCGGAAATACACGCTGCCCCCCGGTGTGGACCCCACCCAAGTTTCCTCCTCCCTGTCCCCTGAGGGCACACTGACCGTGGAGGCCCCCATGCCCAAGCTAGCCACGCAGTCCAACGAGATCACCATCCCAGTCACCTTCGAGTCGCGGGCCCAGCTTGGGGGCCCAGAAGCTGCAAAATCCGATGAGACTGCCGCCAAGTAA |
| ORF Protein Sequence | MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T39921-Ab | Anti-HSPB1/ HSP20/ CMT2F monoclonal antibody |
| Target Antigen | GM-Tg-g-T39921-Ag | HSP20/HSPB1 VLP (virus-like particle) |
| ORF Viral Vector | pGMLV000322 | Human HSPB1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV000837 | Human HSPB1 Lentivirus plasmid |
| ORF Viral Vector | pGMLV001124 | Human HSPB1 Lentivirus plasmid |
| ORF Viral Vector | pGMAD001513 | Human HSPB1 Adenovirus plasmid |
| ORF Viral Vector | vGMLV000322 | Human HSPB1 Lentivirus particle |
| ORF Viral Vector | vGMLV000837 | Human HSPB1 Lentivirus particle |
| ORF Viral Vector | vGMLV001124 | Human HSPB1 Lentivirus particle |
| ORF Viral Vector | vGMAD001513 | Human HSPB1 Adenovirus particle |
Target information
| Target ID | GM-T39921 |
| Target Name | HSP27/HSPB1/HSP20 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
3315 |
| Gene ID |
100059763 (Equus caballus), 101084411 (Felis catus), 15507 (Mus musculus), 24471 (Rattus norvegicus) 3315 (Homo sapiens), 403979 (Canis lupus familiaris), 516099 (Bos taurus), 715615 (Macaca mulatta) |
| Gene Symbols & Synonyms | HSPB1,Hspb1,27kDa,Hsp25,Hsp27,CMT2F,HMN2B,HMND3,HSP27,HSP28,SRP27,HS.76067,HEL-S-102,HSP 27 |
| Target Alternative Names | 27kDa,28 kDa heat shock protein,CMT2F,Estrogen-regulated 24 kDa protein,HEL-S-102,HMN2B,HMND3,HS.76067,HSP 27,HSP20,HSP27,HSP28,HSPB1,Heat shock 27 kDa protein (HSP 27),Heat shock protein beta-1,Heat shock protein family B member 1,Hsp25,Hsp27,HspB1,Hspb1,SRP27,Stress-responsive protein 27 (SRP27) |
| Uniprot Accession |
P04792,P14602,P42929,P42930,Q3T149
Additional SwissProt Accessions: P14602,P42930,P04792,P42929,Q3T149 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target |
| Disease | cancer, Prostate Cancer, Congenital occlusion of ureteropelvic junction, Renal clear cell carcinoma |
| Disease from KEGG | MAPK signaling pathway, Amoebiasis |
| Gene Ensembl | ENSECAG00000020463, ENSMUSG00000004951, ENSG00000106211, ENSCAFG00845004436, ENSBTAG00000011969, ENSMMUG00000056744 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


