Human CTSB/APPS/CPSB ORF/cDNA clone-Lentivirus plasmid (NM_001908.4)

Cat. No.: pGMLV000311
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CTSB/APPS/CPSB Lentiviral expression plasmid for CTSB lentivirus packaging, CTSB lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to Cathepsin B/CTSB/CTSB/APPS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $585.6
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000311
Gene Name CTSB
Accession Number NM_001908.4
Gene ID 1508
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1020 bp
Gene Alias APPS,CPSB
Fluorescent Reporter Null
Mammalian Cell Selection Blasticidin (BSD)
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGCAGCTCTGGGCCTCCCTCTGCTGCCTGCTGGTGTTGGCCAATGCCCGGAGCAGGCCCTCTTTCCATCCCCTGTCGGATGAGCTGGTCAACTATGTCAACAAACGGAATACCACGTGGCAGGCCGGGCACAACTTCTACAACGTGGACATGAGCTACTTGAAGAGGCTATGTGGTACCTTCCTGGGTGGGCCCAAGCCACCCCAGAGAGTTATGTTTACCGAGGACCTGAAGCTGCCTGCAAGCTTCGATGCACGGGAACAATGGCCACAGTGTCCCACCATCAAAGAGATCAGAGACCAGGGCTCCTGTGGCTCCTGCTGGGCCTTCGGGGCTGTGGAAGCCATCTCTGACCGGATCTGCATCCACACCAATGCGCACGTCAGCGTGGAGGTGTCGGCGGAGGACCTGCTCACATGCTGTGGCAGCATGTGTGGGGACGGCTGTAATGGTGGCTATCCTGCTGAAGCTTGGAACTTCTGGACAAGAAAAGGCCTGGTTTCTGGTGGCCTCTATGAATCCCATGTAGGGTGCAGACCGTACTCCATCCCTCCCTGTGAGCACCACGTCAACGGCTCCCGGCCCCCATGCACGGGGGAGGGAGATACCCCCAAGTGTAGCAAGATCTGTGAGCCTGGCTACAGCCCGACCTACAAACAGGACAAGCACTACGGATACAATTCCTACAGCGTCTCCAATAGCGAGAAGGACATCATGGCCGAGATCTACAAAAACGGCCCCGTGGAGGGAGCTTTCTCTGTGTATTCGGACTTCCTGCTCTACAAGTCAGGAGTGTACCAACACGTCACCGGAGAGATGATGGGTGGCCATGCCATCCGCATCCTGGGCTGGGGAGTGGAGAATGGCACACCCTACTGGCTGGTTGCCAACTCCTGGAACACTGACTGGGGTGACAATGGCTTCTTTAAAATACTCAGAGGACAGGATCACTGTGGAATCGAATCAGAAGTGGTGGCTGGAATTCCACGCACCGATCAGTACTGGGAAAAGATCTAA
ORF Protein Sequence MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T61746-Ab Anti-CATB/ CTSB/ APPS functional antibody
    Target Antigen GM-Tg-g-T61746-Ag CTSB protein
    ORF Viral Vector pGMLV000311 Human CTSB Lentivirus plasmid
    ORF Viral Vector vGMLV000311 Human CTSB Lentivirus particle


    Target information

    Target ID GM-T61746
    Target Name Cathepsin B/CTSB
    Gene Group Identifier
    （Target Gene ID in Homo species)         		1508
    Gene ID 100060963 (Equus caballus), 100424758 (Macaca mulatta), 101084873 (Felis catus), 13030 (Mus musculus)
    1508 (Homo sapiens), 281105 (Bos taurus), 486077 (Canis lupus familiaris), 64529 (Rattus norvegicus)
    Gene Symbols & Synonyms CTSB,Ctsb,CB,KWE,APPS,CPSB,RECEUP,CATB
    Target Alternative Names APP secretase (APPS),APPS,CATB,CB,CPSB,CTSB,Cathepsin B,Cathepsin B1,Ctsb,KWE,RECEUP
    Uniprot Accession P00787,P07688,P07858,P10605
    Additional SwissProt Accessions: P10605,P07858,P07688,P00787
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease cancer, Malignant neoplasm of bladder, IgA glomerulonephritis, tumors
    Disease from KEGG Lysosome, Apoptosis, Antigen processing and presentation, NOD-like receptor signaling pathway, Renin secretion
    Gene Ensembl ENSMMUG00000019212, ENSMUSG00000021939, ENSG00000164733, ENSBTAG00000012442, ENSCAFG00845018672
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.