Human NGF/Beta-NGF/HSAN5 ORF/cDNA clone-Lentivirus plasmid (NM_002506.2)

Cat. No.: pGMLV000284
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NGF/Beta-NGF/HSAN5 Lentiviral expression plasmid for NGF lentivirus packaging, NGF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to NGF/beta NGF/NGF/Beta-NGF products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $481.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000284
Gene Name NGF
Accession Number NM_002506.2
Gene ID 4803
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 726 bp
Gene Alias Beta-NGF,HSAN5,NGFB
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCCATGTTGTTCTACACTCTGATCACAGCTTTTCTGATCGGCATACAGGCGGAACCACACTCAGAGAGCAATGTCCCTGCAGGACACACCATCCCCCAAGCCCACTGGACTAAACTTCAGCATTCCCTTGACACTGCCCTTCGCAGAGCCCGCAGCGCCCCGGCAGCGGCGATAGCTGCACGCGTGGCGGGGCAGACCCGCAACATTACTGTGGACCCCAGGCTGTTTAAAAAGCGGCGACTCCGTTCACCCCGTGTGCTGTTTAGCACCCAGCCTCCCCGTGAAGCTGCAGACACTCAGGATCTGGACTTCGAGGTCGGTGGTGCTGCCCCCTTCAACAGGACTCACAGGAGCAAGCGGTCATCATCCCATCCCATCTTCCACAGGGGCGAATTCTCGGTGTGTGACAGTGTCAGCGTGTGGGTTGGGGATAAGACCACCGCCACAGACATCAAGGGCAAGGAGGTGATGGTGTTGGGAGAGGTGAACATTAACAACAGTGTATTCAAACAGTACTTTTTTGAGACCAAGTGCCGGGACCCAAATCCCGTTGACAGCGGGTGCCGGGGCATTGACTCAAAGCACTGGAACTCATATTGTACCACGACTCACACCTTTGTCAAGGCGCTGACCATGGATGGCAAGCAGGCTGCCTGGCGGTTTATCCGGATAGATACGGCCTGTGTGTGTGTGCTCAGCAGGAAGGCTGTGAGAAGAGCCTGA
ORF Protein Sequence MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T85670-Ab Anti-NGF/ Beta-NGF/ HSAN5B functional antibody
    Target Antigen GM-Tg-g-T85670-Ag NGF protein
    Cytokine cks-Tg-g-GM-T85670 Nerve growth factor (NGF) protein & antibody
    ORF Viral Vector pGMLV000284 Human NGF Lentivirus plasmid
    ORF Viral Vector pGMAAV000485 Human NGF Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMPC001164 Human NGF Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV000284 Human NGF Lentivirus particle
    ORF Viral Vector vGMAAV000485 Human NGF Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T85670
    Target Name NGF/beta NGF
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4803
    Gene ID 100065669 (Equus caballus), 100144611 (Felis catus), 18049 (Mus musculus), 281350 (Bos taurus)
    310738 (Rattus norvegicus), 403402 (Canis lupus familiaris), 4803 (Homo sapiens), 711681 (Macaca mulatta)
    Gene Symbols & Synonyms NGF,Ngf,NGFB,Ngfb,beta-NGF,HSAN5,Beta-NGF
    Target Alternative Names Beta-NGF,Beta-nerve growth factor,HSAN5,NGF,NGFB,Ngf,Ngfb,beta NGF,beta-NGF
    Uniprot Accession P01138,P01139,P13600,P25427
    Additional SwissProt Accessions: P01139,P13600,P25427,P01138
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease Overactive bladder, Bladder Pain, Interstitial cystitis (chronic), Urinary Tract Infection, Neurological deficits - peripheral neuropathy, Parkinson's Disease
    Disease from KEGG MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Cytokine-cytokine receptor interaction, PI3K-Akt signaling pathway, Apoptosis, Neurotrophin signaling pathway, Inflammatory mediator regulation of TRP channels
    Gene Ensembl ENSECAG00000010553, ENSMUSG00000027859, ENSBTAG00000007446, ENSCAFG00845027859, ENSG00000134259
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.