Human NGF/Beta-NGF/HSAN5 ORF/cDNA clone-Lentivirus plasmid (NM_002506.2)
Cat. No.: pGMLV000284
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human NGF/Beta-NGF/HSAN5 Lentiviral expression plasmid for NGF lentivirus packaging, NGF lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
NGF/beta NGF/NGF/Beta-NGF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV000284 |
| Gene Name | NGF |
| Accession Number | NM_002506.2 |
| Gene ID | 4803 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 726 bp |
| Gene Alias | Beta-NGF,HSAN5,NGFB |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTCCATGTTGTTCTACACTCTGATCACAGCTTTTCTGATCGGCATACAGGCGGAACCACACTCAGAGAGCAATGTCCCTGCAGGACACACCATCCCCCAAGCCCACTGGACTAAACTTCAGCATTCCCTTGACACTGCCCTTCGCAGAGCCCGCAGCGCCCCGGCAGCGGCGATAGCTGCACGCGTGGCGGGGCAGACCCGCAACATTACTGTGGACCCCAGGCTGTTTAAAAAGCGGCGACTCCGTTCACCCCGTGTGCTGTTTAGCACCCAGCCTCCCCGTGAAGCTGCAGACACTCAGGATCTGGACTTCGAGGTCGGTGGTGCTGCCCCCTTCAACAGGACTCACAGGAGCAAGCGGTCATCATCCCATCCCATCTTCCACAGGGGCGAATTCTCGGTGTGTGACAGTGTCAGCGTGTGGGTTGGGGATAAGACCACCGCCACAGACATCAAGGGCAAGGAGGTGATGGTGTTGGGAGAGGTGAACATTAACAACAGTGTATTCAAACAGTACTTTTTTGAGACCAAGTGCCGGGACCCAAATCCCGTTGACAGCGGGTGCCGGGGCATTGACTCAAAGCACTGGAACTCATATTGTACCACGACTCACACCTTTGTCAAGGCGCTGACCATGGATGGCAAGCAGGCTGCCTGGCGGTTTATCCGGATAGATACGGCCTGTGTGTGTGTGCTCAGCAGGAAGGCTGTGAGAAGAGCCTGA |
| ORF Protein Sequence | MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQAHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNITVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T85670-Ab | Anti-NGF/ Beta-NGF/ HSAN5B functional antibody |
| Target Antigen | GM-Tg-g-T85670-Ag | NGF protein |
| Cytokine | cks-Tg-g-GM-T85670 | Nerve growth factor (NGF) protein & antibody |
| ORF Viral Vector | pGMLV000284 | Human NGF Lentivirus plasmid |
| ORF Viral Vector | pGMAAV000485 | Human NGF Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | pGMPC001164 | Human NGF Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLV000284 | Human NGF Lentivirus particle |
| ORF Viral Vector | vGMAAV000485 | Human NGF Adeno-associate virus(AAV) particle |
Target information
| Target ID | GM-T85670 |
| Target Name | NGF/beta NGF |
|
Gene Group Identifier (Target Gene ID in Homo species) |
4803 |
| Gene ID |
100065669 (Equus caballus), 100144611 (Felis catus), 18049 (Mus musculus), 281350 (Bos taurus) 310738 (Rattus norvegicus), 403402 (Canis lupus familiaris), 4803 (Homo sapiens), 711681 (Macaca mulatta) |
| Gene Symbols & Synonyms | NGF,Ngf,NGFB,Ngfb,beta-NGF,HSAN5,Beta-NGF |
| Target Alternative Names | Beta-NGF,Beta-nerve growth factor,HSAN5,NGF,NGFB,Ngf,Ngfb,beta NGF,beta-NGF |
| Uniprot Accession |
P01138,P01139,P13600,P25427
Additional SwissProt Accessions: P01139,P13600,P25427,P01138 |
| Uniprot Entry Name | |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Cytokine Target |
| Disease | Overactive bladder, Bladder Pain, Interstitial cystitis (chronic), Urinary Tract Infection, Neurological deficits - peripheral neuropathy, Parkinson's Disease |
| Disease from KEGG | MAPK signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Calcium signaling pathway, Cytokine-cytokine receptor interaction, PI3K-Akt signaling pathway, Apoptosis, Neurotrophin signaling pathway, Inflammatory mediator regulation of TRP channels |
| Gene Ensembl | ENSECAG00000010553, ENSMUSG00000027859, ENSBTAG00000007446, ENSCAFG00845027859, ENSG00000134259 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


