Human PCNA/ATLD2 ORF/cDNA clone-Lentivirus plasmid (NM_002592)
Cat. No.: pGMLV000281
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human PCNA/ATLD2 Lentiviral expression plasmid for PCNA lentivirus packaging, PCNA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
PCNA/ATLD2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV000281 |
Gene Name | PCNA |
Accession Number | NM_002592 |
Gene ID | 5111 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 786 bp |
Gene Alias | ATLD2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTTCGAGGCGCGCCTGGTCCAGGGCTCCATCCTCAAGAAGGTGTTGGAGGCACTCAAGGACCTCATCAACGAGGCCTGCTGGGATATTAGCTCCAGCGGTGTAAACCTGCAGAGCATGGACTCGTCCCACGTCTCTTTGGTGCAGCTCACCCTGCGGTCTGAGGGCTTCGACACCTACCGCTGCGACCGCAACCTGGCCATGGGCGTGAACCTCACCAGTATGTCCAAAATACTAAAATGCGCCGGCAATGAAGATATCATTACACTAAGGGCCGAAGATAACGCGGATACCTTGGCGCTAGTATTTGAAGCACCAAACCAGGAGAAAGTTTCAGACTATGAAATGAAGTTGATGGATTTAGATGTTGAACAACTTGGAATTCCAGAACAGGAGTACAGCTGTGTAGTAAAGATGCCTTCTGGTGAATTTGCACGTATATGCCGAGATCTCAGCCATATTGGAGATGCTGTTGTAATTTCCTGTGCAAAAGACGGAGTGAAATTTTCTGCAAGTGGAGAACTTGGAAATGGAAACATTAAATTGTCACAGACAAGTAATGTCGATAAAGAGGAGGAAGCTGTTACCATAGAGATGAATGAACCAGTTCAACTAACTTTTGCACTGAGGTACCTGAACTTCTTTACAAAAGCCACTCCACTCTCTTCAACGGTGACACTCAGTATGTCTGCAGATGTACCCCTTGTTGTAGAGTATAAAATTGCGGATATGGGACACTTAAAATACTACTTGGCTCCCAAGATCGAGGATGAAGAAGGATCTTAG |
ORF Protein Sequence | MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T21782-Ab | Anti-PCNA monoclonal antibody |
Target Antigen | GM-Tg-g-T21782-Ag | PCNA protein |
ORF Viral Vector | pGMLV000281 | Human PCNA Lentivirus plasmid |
ORF Viral Vector | pGMLV000502 | Human PCNA Lentivirus plasmid |
ORF Viral Vector | pGMAP000111 | Human PCNA Adenovirus plasmid |
ORF Viral Vector | vGMLV000281 | Human PCNA Lentivirus particle |
ORF Viral Vector | vGMLV000502 | Human PCNA Lentivirus particle |
ORF Viral Vector | vGMAP000111 | Human PCNA Adenovirus particle |
Target information
Target ID | GM-T21782 |
Target Name | PCNA |
Gene Group Identifier (Target Gene ID in Homo species) |
5111 |
Gene ID |
100052065 (Equus caballus), 101080704 (Felis catus), 18538 (Mus musculus), 25737 (Rattus norvegicus) 477166 (Canis lupus familiaris), 5111 (Homo sapiens), 515499 (Bos taurus), 718006 (Macaca mulatta) |
Gene Symbols & Synonyms | PCNA,Pcna,PCNAR,Pcna/cyclin,ATLD2 |
Target Alternative Names | PCNA,Proliferating cell nuclear antigen,PCNA,Cyclin,ATLD2 |
Uniprot Accession |
P04961,P12004,P17918,Q3ZBW4
Additional SwissProt Accessions: P17918,P04961,P12004,Q3ZBW4 |
Uniprot Entry Name | |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | cancer, Aggressive angiomyxoma (AAM), breast cancer, Proliferation and growth regulation |
Disease from KEGG | Tight junction, Hepatitis B |
Gene Ensembl | ENSECAG00000013162, ENSMUSG00000027342, ENSCAFG00845028229, ENSG00000132646, ENSBTAG00000006065, ENSMMUG00000013259 |
Target Classification |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.