Human HMGA2/BABL/HMGI-C ORF/cDNA clone-Lentivirus plasmid (NM_003483.4)

Cat. No.: pGMLV000254
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HMGA2/BABL/HMGI-C Lentiviral expression plasmid for HMGA2 lentivirus packaging, HMGA2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to HMGA2/BABL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000254
Gene Name HMGA2
Accession Number NM_003483.4
Gene ID 8091
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 330 bp
Gene Alias BABL,HMGI-C,HMGIC,LIPO,STQTL9
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCGCACGCGGTGAGGGCGCGGGGCAGCCGTCCACTTCAGCCCAGGGACAACCTGCCGCCCCAGCGCCTCAGAAGAGAGGACGCGGCCGCCCCAGGAAGCAGCAGCAAGAACCAACCGGTGAGCCCTCTCCTAAGAGACCCAGGGGAAGACCCAAAGGCAGCAAAAACAAGAGTCCCTCTAAAGCAGCTCAAAAGAAAGCAGAAGCCACTGGAGAAAAACGGCCAAGAGGCAGACCTAGGAAATGGCCACAACAAGTTGTTCAGAAGAAGCCTGCTCAGGAGGAAACTGAAGAGACATCCTCACAAGAGTCTGCCGAAGAGGACTAG
ORF Protein Sequence MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T48166-Ab Anti-HMGA2 monoclonal antibody
    Target Antigen GM-Tg-g-T48166-Ag HMGA2 protein
    ORF Viral Vector pGMLV000253 Human HMGA2 Lentivirus plasmid
    ORF Viral Vector pGMLV000254 Human HMGA2 Lentivirus plasmid
    ORF Viral Vector vGMLV000253 Human HMGA2 Lentivirus particle
    ORF Viral Vector vGMLV000254 Human HMGA2 Lentivirus particle


    Target information

    Target ID GM-T48166
    Target Name HMGA2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		8091
    Gene ID 100271859 (Canis lupus familiaris), 100297155 (Bos taurus), 102149270 (Equus caballus), 111561386 (Felis catus)
    15364 (Mus musculus), 717721 (Macaca mulatta), 8091 (Homo sapiens), 84017 (Rattus norvegicus)
    Gene Symbols & Synonyms HMGA2,Hmga2,pg,Hmgic,pygmy,HMGI-C,9430083A20Rik,BABL,LIPO,SRS5,HMGIC,STQTL9
    Target Alternative Names 9430083A20Rik,BABL,HMGA2,HMGI-C,HMGIC,High mobility group AT-hook protein 2,High mobility group protein HMGI-C,Hmga2,Hmgic,LIPO,SRS5,STQTL9,pg,pygmy
    Uniprot Accession P52926,P52927
    Additional SwissProt Accessions: P52927,P52926
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSCAFG00845012436, ENSBTAG00000044118, ENSECAG00000040252, ENSMUSG00000056758, ENSG00000149948
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.