Human TNFSF9/4-1BB-L/CD137L ORF/cDNA clone-Lentivirus plasmid (NM_003811.3)

Cat. No.: pGMLV000252
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TNFSF9/4-1BB-L/CD137L Lentiviral expression plasmid for TNFSF9 lentivirus packaging, TNFSF9 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to 4-1BBL/TNFSF9/TNFSF9/4-1BB-L products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $491.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000252
Gene Name TNFSF9
Accession Number NM_003811.3
Gene ID 8744
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 765 bp
Gene Alias 4-1BB-L,CD137L,TNLG5A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAATACGCCTCTGACGCTTCACTGGACCCCGAAGCCCCGTGGCCTCCCGCGCCCCGCGCTCGCGCCTGCCGCGTACTGCCTTGGGCCCTGGTCGCGGGGCTGCTGCTGCTGCTGCTGCTCGCTGCCGCCTGCGCCGTCTTCCTCGCCTGCCCCTGGGCCGTGTCCGGGGCTCGCGCCTCGCCCGGCTCCGCGGCCAGCCCGAGACTCCGCGAGGGTCCCGAGCTTTCGCCCGACGATCCCGCCGGCCTCTTGGACCTGCGGCAGGGCATGTTTGCGCAGCTGGTGGCCCAAAATGTTCTGCTGATCGATGGGCCCCTGAGCTGGTACAGTGACCCAGGCCTGGCAGGCGTGTCCCTGACGGGGGGCCTGAGCTACAAAGAGGACACGAAGGAGCTGGTGGTGGCCAAGGCTGGAGTCTACTATGTCTTCTTTCAACTAGAGCTGCGGCGCGTGGTGGCCGGCGAGGGCTCAGGCTCCGTTTCACTTGCGCTGCACCTGCAGCCACTGCGCTCTGCTGCTGGGGCCGCCGCCCTGGCTTTGACCGTGGACCTGCCACCCGCCTCCTCCGAGGCTCGGAACTCGGCCTTCGGTTTCCAGGGCCGCTTGCTGCACCTGAGTGCCGGCCAGCGCCTGGGCGTCCATCTTCACACTGAGGCCAGGGCACGCCATGCCTGGCAGCTTACCCAGGGCGCCACAGTCTTGGGACTCTTCCGGGTGACCCCCGAAATCCCAGCCGGACTCCCTTCACCGAGGTCGGAATAA
ORF Protein Sequence MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IO001-Ab Anti-TNFL9/ 4-1BBL/ TNFSF9 monoclonal antibody
    Target Antigen GM-Tg-g-IO001-Ag 4-1BBL/TNFSF9 VLP (virus-like particle)
    Cytokine cks-Tg-g-GM-IO001 tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9) protein & antibody
    ORF Viral Vector pGMLV000252 Human TNFSF9 Lentivirus plasmid
    ORF Viral Vector vGMLV000252 Human TNFSF9 Lentivirus particle


    Target information

    Target ID GM-IO001
    Target Name 4-1BBL/TNFSF9
    Gene Group Identifier
    （Target Gene ID in Homo species)         		8744
    Gene ID 101087207 (Felis catus), 102150292 (Equus caballus), 21950 (Mus musculus), 353218 (Rattus norvegicus)
    476729 (Canis lupus familiaris), 521748 (Bos taurus), 700588 (Macaca mulatta), 8744 (Homo sapiens)
    Gene Symbols & Synonyms TNFSF9,Tnfsf9,Ly63l,4-1BBL,Cd137l,4-1BB-L,Tnlg5a,TNLG5A,CD137L
    Target Alternative Names 4-1BB ligand (4-1BBL),4-1BB-L,4-1BBL,CD137L,Cd137l,Ly63l,TNFSF9,TNLG5A,Tnfsf9,Tnlg5a,Tumor necrosis factor ligand superfamily member 9
    Uniprot Accession P41273,P41274
    Additional SwissProt Accessions: P41274,P41273
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction
    Gene Ensembl ENSECAG00000022714, ENSMUSG00000035678, ENSBTAG00000046266, ENSMMUG00000001985, ENSG00000125657
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.