Human CD81/CVID6/S5.7 ORF/cDNA clone-Lentivirus plasmid (NM_004356.3)
Cat. No.: pGMLV000243
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CD81/CVID6/S5.7 Lentiviral expression plasmid for CD81 lentivirus packaging, CD81 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
CD81/CVID6 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV000243 |
| Gene Name | CD81 |
| Accession Number | NM_004356.3 |
| Gene ID | 975 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 711 bp |
| Gene Alias | CVID6,S5.7,TAPA1,TSPAN28 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | Null |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGGAGTGGAGGGCTGCACCAAGTGCATCAAGTACCTGCTCTTCGTCTTCAATTTCGTCTTCTGGCTGGCTGGAGGCGTGATCCTGGGTGTGGCCCTGTGGCTCCGCCATGACCCGCAGACCACCAACCTCCTGTATCTGGAGCTGGGAGACAAGCCCGCGCCCAACACCTTCTATGTAGGCATCTACATCCTCATCGCTGTGGGCGCTGTCATGATGTTCGTTGGCTTCCTGGGCTGCTACGGGGCCATCCAGGAATCCCAGTGCCTGCTGGGGACGTTCTTCACCTGCCTGGTCATCCTGTTTGCCTGTGAGGTGGCCGCCGGCATCTGGGGCTTTGTCAACAAGGACCAGATCGCCAAGGATGTGAAGCAGTTCTATGACCAGGCCCTACAGCAGGCCGTGGTGGATGATGACGCCAACAACGCCAAGGCTGTGGTGAAGACCTTCCACGAGACGCTTGACTGCTGTGGCTCCAGCACACTGACTGCTTTGACCACCTCAGTGCTCAAGAACAATTTGTGTCCCTCGGGCAGCAACATCATCAGCAACCTCTTCAAGGAGGACTGCCACCAGAAGATCGATGACCTCTTCTCCGGGAAGCTGTACCTCATCGGCATTGCTGCCATCGTGGTCGCTGTGATCATGATCTTCGAGATGATCCTGAGCATGGTGCTGTGCTGTGGCATCCGGAACAGCTCCGTGTACTGA |
| ORF Protein Sequence | MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0217-Ab | Anti-CD81/ CVID6/ S5.7 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0217-Ag | CD81 VLP (virus-like particle) |
| ORF Viral Vector | pGMLV000243 | Human CD81 Lentivirus plasmid |
| ORF Viral Vector | vGMLV000243 | Human CD81 Lentivirus particle |
Target information
| Target ID | GM-MP0217 |
| Target Name | CD81 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
975 |
| Gene ID |
100060480 (Equus caballus), 101093144 (Felis catus), 12520 (Mus musculus), 25621 (Rattus norvegicus) 511435 (Bos taurus), 611606 (Canis lupus familiaris), 704961 (Macaca mulatta), 975 (Homo sapiens) |
| Gene Symbols & Synonyms | CD81,Cd81,Tapa1,Tapa-1,Tspan28,S5.7,CVID6,TAPA1,TSPAN28 |
| Target Alternative Names | 26 kDa cell surface protein TAPA-1,CD81,CD81 antigen,CVID6,Cd81,S5.7,TAPA1,TSPAN28,Tapa-1,Tapa1,Target of the antiproliferative antibody 1,Tetraspanin-28 (Tspan-28),Tspan28 |
| Uniprot Accession |
P35762,P60033,Q3ZCD0,Q62745
Additional SwissProt Accessions: P35762,Q62745,Q3ZCD0,P60033 |
| Uniprot Entry Name | |
| Protein Sub-location | Transmembrane Protein |
| Category | |
| Disease | cancer |
| Disease from KEGG | B cell receptor signaling pathway, Malaria, Hepatitis C |
| Gene Ensembl | ENSECAG00000024654, ENSMUSG00000037706, ENSCAFG00845010894, ENSMMUG00000002043, ENSG00000110651 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


