Human CD81/CVID6/S5.7 ORF/cDNA clone-Lentivirus plasmid (NM_004356.3)

Cat. No.: pGMLV000243
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CD81/CVID6/S5.7 Lentiviral expression plasmid for CD81 lentivirus packaging, CD81 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CD81/CVID6 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $477.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000243
Gene Name CD81
Accession Number NM_004356.3
Gene ID 975
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 711 bp
Gene Alias CVID6,S5.7,TAPA1,TSPAN28
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGAGTGGAGGGCTGCACCAAGTGCATCAAGTACCTGCTCTTCGTCTTCAATTTCGTCTTCTGGCTGGCTGGAGGCGTGATCCTGGGTGTGGCCCTGTGGCTCCGCCATGACCCGCAGACCACCAACCTCCTGTATCTGGAGCTGGGAGACAAGCCCGCGCCCAACACCTTCTATGTAGGCATCTACATCCTCATCGCTGTGGGCGCTGTCATGATGTTCGTTGGCTTCCTGGGCTGCTACGGGGCCATCCAGGAATCCCAGTGCCTGCTGGGGACGTTCTTCACCTGCCTGGTCATCCTGTTTGCCTGTGAGGTGGCCGCCGGCATCTGGGGCTTTGTCAACAAGGACCAGATCGCCAAGGATGTGAAGCAGTTCTATGACCAGGCCCTACAGCAGGCCGTGGTGGATGATGACGCCAACAACGCCAAGGCTGTGGTGAAGACCTTCCACGAGACGCTTGACTGCTGTGGCTCCAGCACACTGACTGCTTTGACCACCTCAGTGCTCAAGAACAATTTGTGTCCCTCGGGCAGCAACATCATCAGCAACCTCTTCAAGGAGGACTGCCACCAGAAGATCGATGACCTCTTCTCCGGGAAGCTGTACCTCATCGGCATTGCTGCCATCGTGGTCGCTGTGATCATGATCTTCGAGATGATCCTGAGCATGGTGCTGTGCTGTGGCATCCGGAACAGCTCCGTGTACTGA
ORF Protein Sequence MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTNLLYLELGDKPAPNTFYVGIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0217-Ab Anti-CD81/ CVID6/ S5.7 monoclonal antibody
    Target Antigen GM-Tg-g-MP0217-Ag CD81 VLP (virus-like particle)
    ORF Viral Vector pGMLV000243 Human CD81 Lentivirus plasmid
    ORF Viral Vector vGMLV000243 Human CD81 Lentivirus particle


    Target information

    Target ID GM-MP0217
    Target Name CD81
    Gene Group Identifier
    (Target Gene ID in Homo species)
    975
    Gene ID 100060480 (Equus caballus), 101093144 (Felis catus), 12520 (Mus musculus), 25621 (Rattus norvegicus)
    511435 (Bos taurus), 611606 (Canis lupus familiaris), 704961 (Macaca mulatta), 975 (Homo sapiens)
    Gene Symbols & Synonyms CD81,Cd81,Tapa1,Tapa-1,Tspan28,S5.7,CVID6,TAPA1,TSPAN28
    Target Alternative Names 26 kDa cell surface protein TAPA-1,CD81,CD81 antigen,CVID6,Cd81,S5.7,TAPA1,TSPAN28,Tapa-1,Tapa1,Target of the antiproliferative antibody 1,Tetraspanin-28 (Tspan-28),Tspan28
    Uniprot Accession P35762,P60033,Q3ZCD0,Q62745
    Additional SwissProt Accessions: P35762,Q62745,Q3ZCD0,P60033
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG B cell receptor signaling pathway, Malaria, Hepatitis C
    Gene Ensembl ENSECAG00000024654, ENSMUSG00000037706, ENSCAFG00845010894, ENSMMUG00000002043, ENSG00000110651
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.