Human CCL20/CKb4/Exodus ORF/cDNA clone-Lentivirus plasmid (NM_004591.2)

Cat. No.: pGMLV000235
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCL20/CKb4/Exodus Lentiviral expression plasmid for CCL20 lentivirus packaging, CCL20 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CCL20/MIP-3 alpha/CCL20/CKb4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000235
Gene Name CCL20
Accession Number NM_004591.2
Gene ID 6364
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 291 bp
Gene Alias CKb4,Exodus,LARC,MIP-3-alpha,MIP-3a,MIP3A,SCYA20,ST38
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGCTGTACCAAGAGTTTGCTCCTGGCTGCTTTGATGTCAGTGCTGCTACTCCACCTCTGCGGCGAATCAGAAGCAGCAAGCAACTTTGACTGCTGTCTTGGATACACAGACCGTATTCTTCATCCTAAATTTATTGTGGGCTTCACACGGCAGCTGGCCAATGAAGGCTGTGACATCAATGCTATCATCTTTCACACAAAGAAAAAGTTGTCTGTGTGCGCAAATCCAAAACAGACTTGGGTGAAATATATTGTGCGTCTCCTCAGTAAAAAAGTCAAGAACATGTAA
ORF Protein Sequence MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T04894-Ab Anti-CCL20/ CKb4/ Exodus functional antibody
    Target Antigen GM-Tg-g-T04894-Ag CCL20 protein
    Cytokine cks-Tg-g-GM-T04894 chemokine (C-C motif) ligand 20 (CCL20) protein & antibody
    ORF Viral Vector pGMLV000235 Human CCL20 Lentivirus plasmid
    ORF Viral Vector pGMAAV000788 Human CCL20 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLV000235 Human CCL20 Lentivirus particle
    ORF Viral Vector vGMAAV000788 Human CCL20 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T04894
    Target Name CCL20/MIP-3 alpha
    Gene Group Identifier
    (Target Gene ID in Homo species)
    6364
    Gene ID 100629808 (Equus caballus), 101089032 (Felis catus), 20297 (Mus musculus), 281666 (Bos taurus)
    29538 (Rattus norvegicus), 448790 (Canis lupus familiaris), 574182 (Macaca mulatta), 6364 (Homo sapiens)
    Gene Symbols & Synonyms CCL20,Ccl20,CKb4,LARC,ST38,MIP3A,MIP-3A,Scya20,MIP-3[a],exodus-1,Exodus,MIP-3a,SCYA20,MIP-3-alpha
    Target Alternative Names Beta-chemokine exodus-1,C-C motif chemokine 20,CC chemokine LARC,CCL20,CKb4,Ccl20,Exodus,LARC,Liver and activation-regulated chemokine,MIP-3 alpha,MIP-3-alpha,MIP-3A,MIP-3[a],MIP-3a,MIP3A,Macrophage inflammatory protein 3 alpha (MIP-3-alpha),SCYA20,ST38,Scya20,Small-inducible cytokine A20,exodus-1
    Uniprot Accession O89093,P78556,P97884,Q8SQB1
    Additional SwissProt Accessions: O89093,Q8SQB1,P97884,P78556
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Immuno-oncology Target, Cytokine Target
    Disease cancer, Prostate Cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, Chemokine signaling pathway, IL-17 signaling pathway, TNF signaling pathway, Rheumatoid arthritis
    Gene Ensembl ENSMUSG00000026166, ENSBTAG00000021326, ENSCAFG00845017158, ENSMMUG00000013250, ENSG00000115009
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.