Human EBI3/IL-27B/IL27B ORF/cDNA clone-Lentivirus plasmid (NM_005755)

Cat. No.: pGMLV000206
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EBI3/IL-27B/IL27B Lentiviral expression plasmid for EBI3 lentivirus packaging, EBI3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to EBI3/IL35/EBI3/IL-27B products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $472.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000206
Gene Name EBI3
Accession Number NM_005755
Gene ID 10148
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 690 bp
Gene Alias IL-27B,IL27B,IL35B
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACCCCGCAGCTTCTCCTGGCCCTTGTCCTCTGGGCCAGCTGCCCGCCCTGCAGTGGAAGGAAAGGGCCCCCAGCAGCTCTGACACTGCCCCGGGTGCAATGCCGAGCCTCTCGGTACCCGATCGCCGTGGATTGCTCCTGGACCCTGCCGCCTGCTCCAAACTCCACCAGCCCCGTGTCCTTCATTGCCACGTACAGGCTCGGCATGGCTGCCCGGGGCCACAGCTGGCCCTGCCTGCAGCAGACGCCAACGTCCACCAGCTGCACCATCACGGATGTCCAGCTGTTCTCCATGGCTCCCTACGTGCTCAATGTCACCGCCGTCCACCCCTGGGGCTCCAGCAGCAGCTTCGTGCCTTTCATAACAGAGCACATCATCAAGCCCGACCCTCCAGAAGGCGTGCGCCTAAGCCCCCTCGCTGAGCGCCAGCTACAGGTGCAGTGGGAGCCTCCCGGGTCCTGGCCCTTCCCAGAGATCTTCTCACTGAAGTACTGGATCCGTTACAAGCGTCAGGGAGCTGCGCGCTTCCACCGGGTGGGGCCCATTGAAGCCACGTCCTTCATCCTCAGGGCTGTGCGGCCCCGAGCCAGGTACTACGTCCAAGTGGCGGCTCAGGACCTCACAGACTACGGGGAACTGAGTGACTGGAGTCTCCCCGCCACTGCCACAATGAGCCTGGGCAAGTAG
ORF Protein Sequence MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T02231-Ab Anti-IL27B/ IL35/ EBI3 monoclonal antibody
    Target Antigen GM-Tg-g-T02231-Ag IL35/EBI3 VLP (virus-like particle)
    ORF Viral Vector pGMLV000206 Human EBI3 Lentivirus plasmid
    ORF Viral Vector pGMLV001553 Human EBI3 Lentivirus plasmid
    ORF Viral Vector vGMLV000206 Human EBI3 Lentivirus particle
    ORF Viral Vector vGMLV001553 Human EBI3 Lentivirus particle


    Target information

    Target ID GM-T02231
    Target Name EBI3/IL35
    Gene Group Identifier
    （Target Gene ID in Homo species)         		10148
    Gene ID 100063061 (Equus caballus), 101101032 (Felis catus), 10148 (Homo sapiens), 485043 (Canis lupus familiaris)
    50498 (Mus musculus), 514933 (Bos taurus), 680609 (Rattus norvegicus), 721832 (Macaca mulatta)
    Gene Symbols & Synonyms EBI3,Ebi3,IL27B,IL35B,IL-27B,EBI-3,IL-27
    Target Alternative Names EBI3, IL35,Interleukin-27 subunit beta,IL-27 subunit beta, IL-27B,Epstein-Barr virus-induced gene 3 protein (EBV-induced gene 3 protein),IL27B,IL35B,IL-27B
    Uniprot Accession O35228,Q14213
    Additional SwissProt Accessions: Q14213,O35228
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, Th17 cell differentiation
    Gene Ensembl ENSECAG00000018667, ENSG00000105246, ENSCAFG00845006245, ENSMUSG00000003206, ENSBTAG00000012829, ENSMMUG00000028928
    Target Classification Checkpoint-Immuno Oncology


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.