Human EBI3/IL-27B/IL27B ORF/cDNA clone-Lentivirus plasmid (NM_005755)
Cat. No.: pGMLV000206
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human EBI3/IL-27B/IL27B Lentiviral expression plasmid for EBI3 lentivirus packaging, EBI3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
EBI3/IL35/EBI3/IL-27B products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV000206 |
Gene Name | EBI3 |
Accession Number | NM_005755 |
Gene ID | 10148 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 690 bp |
Gene Alias | IL-27B,IL27B,IL35B |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACCCCGCAGCTTCTCCTGGCCCTTGTCCTCTGGGCCAGCTGCCCGCCCTGCAGTGGAAGGAAAGGGCCCCCAGCAGCTCTGACACTGCCCCGGGTGCAATGCCGAGCCTCTCGGTACCCGATCGCCGTGGATTGCTCCTGGACCCTGCCGCCTGCTCCAAACTCCACCAGCCCCGTGTCCTTCATTGCCACGTACAGGCTCGGCATGGCTGCCCGGGGCCACAGCTGGCCCTGCCTGCAGCAGACGCCAACGTCCACCAGCTGCACCATCACGGATGTCCAGCTGTTCTCCATGGCTCCCTACGTGCTCAATGTCACCGCCGTCCACCCCTGGGGCTCCAGCAGCAGCTTCGTGCCTTTCATAACAGAGCACATCATCAAGCCCGACCCTCCAGAAGGCGTGCGCCTAAGCCCCCTCGCTGAGCGCCAGCTACAGGTGCAGTGGGAGCCTCCCGGGTCCTGGCCCTTCCCAGAGATCTTCTCACTGAAGTACTGGATCCGTTACAAGCGTCAGGGAGCTGCGCGCTTCCACCGGGTGGGGCCCATTGAAGCCACGTCCTTCATCCTCAGGGCTGTGCGGCCCCGAGCCAGGTACTACGTCCAAGTGGCGGCTCAGGACCTCACAGACTACGGGGAACTGAGTGACTGGAGTCTCCCCGCCACTGCCACAATGAGCCTGGGCAAGTAG |
ORF Protein Sequence | MTPQLLLALVLWASCPPCSGRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T02231-Ab | Anti-IL27B/ IL35/ EBI3 monoclonal antibody |
Target Antigen | GM-Tg-g-T02231-Ag | IL35/EBI3 VLP (virus-like particle) |
ORF Viral Vector | pGMLV000206 | Human EBI3 Lentivirus plasmid |
ORF Viral Vector | pGMLV001553 | Human EBI3 Lentivirus plasmid |
ORF Viral Vector | vGMLV000206 | Human EBI3 Lentivirus particle |
ORF Viral Vector | vGMLV001553 | Human EBI3 Lentivirus particle |
Target information
Target ID | GM-T02231 |
Target Name | EBI3/IL35 |
Gene Group Identifier (Target Gene ID in Homo species) |
10148 |
Gene ID |
100063061 (Equus caballus), 101101032 (Felis catus), 10148 (Homo sapiens), 485043 (Canis lupus familiaris) 50498 (Mus musculus), 514933 (Bos taurus), 680609 (Rattus norvegicus), 721832 (Macaca mulatta) |
Gene Symbols & Synonyms | EBI3,Ebi3,IL27B,IL35B,IL-27B,EBI-3,IL-27 |
Target Alternative Names | EBI3, IL35,Interleukin-27 subunit beta,IL-27 subunit beta, IL-27B,Epstein-Barr virus-induced gene 3 protein (EBV-induced gene 3 protein),IL27B,IL35B,IL-27B |
Uniprot Accession |
O35228,Q14213
Additional SwissProt Accessions: Q14213,O35228 |
Uniprot Entry Name | |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target, Immuno-oncology Target |
Disease | |
Disease from KEGG | Cytokine-cytokine receptor interaction, Th17 cell differentiation |
Gene Ensembl | ENSECAG00000018667, ENSG00000105246, ENSCAFG00845006245, ENSMUSG00000003206, ENSBTAG00000012829, ENSMMUG00000028928 |
Target Classification | Checkpoint-Immuno Oncology |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.