Human IL24/C49A/FISP ORF/cDNA clone-Lentivirus plasmid (NM_006850)

Cat. No.: pGMLV000181
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL24/C49A/FISP Lentiviral expression plasmid for IL24 lentivirus packaging, IL24 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to IL-24/IL24/IL24/C49A products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $455.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000181
Gene Name IL24
Accession Number NM_006850
Gene ID 11009
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 621 bp
Gene Alias C49A,FISP,IL10B,MDA7,MOB5,ST16
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAATTTTCAACAGAGGCTGCAAAGCCTGTGGACTTTAGCCAGACCCTTCTGCCCTCCTTTGCTGGCGACAGCCTCTCAAATGCAGATGGTTGTGCTCCCTTGCCTGGGTTTTACCCTGCTTCTCTGGAGCCAGGTATCAGGGGCCCAGGGCCAAGAATTCCACTTTGGGCCCTGCCAAGTGAAGGGGGTTGTTCCCCAGAAACTGTGGGAAGCCTTCTGGGCTGTGAAAGACACTATGCAAGCTCAGGATAACATCACGAGTGCCCGGCTGCTGCAGCAGGAGGTTCTGCAGAACGTCTCGGATGCTGAGAGCTGTTACCTTGTCCACACCCTGCTGGAGTTCTACTTGAAAACTGTTTTCAAAAACTACCACAATAGAACAGTTGAAGTCAGGACTCTGAAGTCATTCTCTACTCTGGCCAACAACTTTGTTCTCATCGTGTCACAACTGCAACCCAGTCAAGAAAATGAGATGTTTTCCATCAGAGACAGTGCACACAGGCGGTTTCTGCTATTCCGGAGAGCATTCAAACAGTTGGACGTAGAAGCAGCTCTGACCAAAGCCCTTGGGGAAGTGGACATTCTTCTGACCTGGATGCAGAAATTCTACAAGCTCTGA
ORF Protein Sequence MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T93450-Ab Anti-IL24/ C49A/ FISP functional antibody
    Target Antigen GM-Tg-g-T93450-Ag IL24 protein
    Cytokine cks-Tg-g-GM-T93450 interleukin 24 (IL24) protein & antibody
    ORF Viral Vector pGMLV000181 Human IL24 Lentivirus plasmid
    ORF Viral Vector pGMAD000195 Human IL24 Adenovirus plasmid
    ORF Viral Vector pGMLP-IL-031 Human IL24 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-114 Human IL24 Adenovirus plasmid
    ORF Viral Vector vGMLV000181 Human IL24 Lentivirus particle
    ORF Viral Vector vGMAD000195 Human IL24 Adenovirus particle
    ORF Viral Vector vGMLP-IL-031 Human IL24 Lentivirus particle
    ORF Viral Vector vGMAP-IL-114 Human IL24 Adenovirus particle


    Target information

    Target ID GM-T93450
    Target Name IL-24/IL24
    Gene Group Identifier
    （Target Gene ID in Homo species)         		11009
    Gene ID 100055675 (Equus caballus), 101095874 (Felis catus), 11009 (Homo sapiens), 170819 (Rattus norvegicus)
    526285 (Bos taurus), 609213 (Canis lupus familiaris), 694541 (Macaca mulatta), 93672 (Mus musculus)
    Gene Symbols & Synonyms IL24,Il24,C49A,FISP,MDA7,MOB5,ST16,IL10B,If2e,Mda7,Mda-7,St16
    Target Alternative Names C49A,FISP,IL-24,IL10B,IL24,If2e,Il24,Interleukin-24,MDA7,MOB5,Mda-7,Mda7,Melanoma differentiation-associated gene 7 protein (MDA-7),ST16,St16,Suppression of tumorigenicity 16 protein
    Uniprot Accession Q13007,Q925S4,Q9JI24
    Additional SwissProt Accessions: Q13007,Q9JI24,Q925S4
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease cancer
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor, JAK-STAT signaling pathway
    Gene Ensembl ENSECAG00000012240, ENSG00000162892, ENSBTAG00000007851, ENSCAFG00845001393, ENSMUSG00000026420
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.