Human IL37/FIL1/FIL1(ZETA) ORF/cDNA clone-Lentivirus plasmid (NM_014439)

Cat. No.: pGMLV000120
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IL37/FIL1/FIL1(ZETA) Lentiviral expression plasmid for IL37 lentivirus packaging, IL37 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to IL-1F7/IL-37/IL37/IL37/FIL1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $464.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000120
Gene Name IL37
Accession Number NM_014439
Gene ID 27178
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 657 bp
Gene Alias FIL1,FIL1(ZETA),FIL1Z,IL-1F7,IL-1H,IL-1H4,IL-1RP1,IL-37,IL1F7,IL1H4,IL1RP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCCTTTGTGGGGGAGAACTCAGGAGTGAAAATGGGCTCTGAGGACTGGGAAAAAGATGAACCCCAGTGCTGCTTAGAAGACCCGGCTGGAAGCCCCCTGGAACCAGGCCCAAGCCTCCCCACCATGAATTTTGTTCACACAAGTCCAAAGGTGAAGAACTTAAACCCGAAGAAATTCAGCATTCATGACCAGGATCACAAAGTACTGGTCCTGGACTCTGGGAATCTCATAGCAGTTCCAGATAAAAACTACATACGCCCAGAGATCTTCTTTGCATTAGCCTCATCCTTGAGCTCAGCCTCTGCGGAGAAAGGAAGTCCGATTCTCCTGGGGGTCTCTAAAGGGGAGTTTTGTCTCTACTGTGACAAGGATAAAGGACAAAGTCATCCATCCCTTCAGCTGAAGAAGGAGAAACTGATGAAGCTGGCTGCCCAAAAGGAATCAGCACGCCGGCCCTTCATCTTTTATAGGGCTCAGGTGGGCTCCTGGAACATGCTGGAGTCGGCGGCTCACCCCGGATGGTTCATCTGCACCTCCTGCAATTGTAATGAGCCTGTTGGGGTGACAGATAAATTTGAGAACAGGAAACACATTGAATTTTCATTTCAACCAGTTTGCAAAGCTGAAATGAGCCCCAGTGAGGTCAGCGATTAG
ORF Protein Sequence MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T96845-Ab Anti-IL37/ FIL1/ FIL1(ZETA) functional antibody
    Target Antigen GM-Tg-g-T96845-Ag IL37 protein
    Cytokine cks-Tg-g-GM-T96845 interleukin 37 (IL37) protein & antibody
    ORF Viral Vector pGMLV000120 Human IL37 Lentivirus plasmid
    ORF Viral Vector pGMAAV000475 Human IL37 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMAP000269 Human IL1F7 Adenovirus plasmid
    ORF Viral Vector pGMLP-IL-043 Human IL37 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-126 Human IL37 Adenovirus plasmid
    ORF Viral Vector vGMLV000120 Human IL37 Lentivirus particle
    ORF Viral Vector vGMAAV000475 Human IL37 Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMAP000269 Human IL1F7 Adenovirus particle
    ORF Viral Vector vGMLP-IL-043 Human IL37 Lentivirus particle
    ORF Viral Vector vGMAP-IL-126 Human IL37 Adenovirus particle


    Target information

    Target ID GM-T96845
    Target Name IL-1F7/IL-37/IL37
    Gene Group Identifier
    (Target Gene ID in Homo species)
    27178
    Gene ID 100052470 (Equus caballus), 100686057 (Canis lupus familiaris), 27178 (Homo sapiens), 700579 (Macaca mulatta)
    786493 (Bos taurus)
    Gene Symbols & Synonyms IL37,FIL1,FIL1Z,IL-1H,IL-23,IL-37,IL1F7,IL1H4,IL-1F7,IL-1H4,IL1RP1,IL-1RP1,FIL1(ZETA)
    Target Alternative Names IL-1F7, IL-37, IL37,Interleukin-37,IL-37,FIL1 zeta, IL-1X, Interleukin-1 family member 7 (IL-1F7), Interleukin-1 homolog 4 (IL-1H, IL-1H4), Interleukin-1 zeta (IL-1 zeta), Interleukin-1-related protein (IL-1RP1),FIL1,FIL1Z,IL-1H,IL-23,IL-37,IL1F7,IL1H4,IL-1F7,IL-1H4,IL1RP1,IL-1RP1,FIL1(ZETA)
    Uniprot Accession Q9NZH6
    Additional SwissProt Accessions: Q9NZH6
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, Cytokine Target
    Disease
    Disease from KEGG Cytokine-cytokine receptor interaction, Viral protein interaction with cytokine and cytokine receptor
    Gene Ensembl ENSECAG00000015732, ENSCAFG00845011516, ENSG00000125571, ENSMMUG00000005922, ENSBTAG00000013675
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.