Human DIABLO/DFNA64/SMAC ORF/cDNA clone-Lentivirus plasmid (NM_019887)

Cat. No.: pGMLV000088
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DIABLO/DFNA64/SMAC Lentiviral expression plasmid for DIABLO lentivirus packaging, DIABLO lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to DIABLO/Smac/DIABLO/DFNA64 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $480
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000088
Gene Name DIABLO
Accession Number NM_019887
Gene ID 56616
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 720 bp
Gene Alias DFNA64,SMAC
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCTCTGAAGAGTTGGCTGTCGCGCAGCGTAACTTCATTCTTCAGGTACAGACAGTGTTTGTGTGTTCCTGTTGTGGCTAACTTTAAGAAGCGGTGTTTCTCAGAATTGATAAGACCATGGCACAAAACTGTGACGATTGGCTTTGGAGTAACCCTGTGTGCGGTTCCTATTGCACAGAAATCAGAGCCTCATTCCCTTAGTAGTGAAGCATTGATGAGGAGAGCAGTGTCTTTGGTAACAGATAGCACCTCTACCTTTCTCTCTCAGACCACATATGCGTTGATTGAAGCTATTACTGAATATACTAAGGCTGTTTATACCTTAACTTCTCTTTACCGACAATATACAAGTTTACTTGGGAAAATGAATTCAGAGGAGGAAGATGAAGTGTGGCAGGTGATCATAGGAGCCAGAGCTGAGATGACTTCAAAACACCAAGAGTACTTGAAGCTGGAAACCACTTGGATGACTGCAGTTGGTCTTTCAGAGATGGCAGCAGAAGCTGCATATCAAACTGGCGCAGATCAGGCCTCTATAACCGCCAGGAATCACATTCAGCTGGTGAAACTGCAGGTGGAAGAGGTGCACCAGCTCTCCCGGAAAGCAGAAACCAAGCTGGCAGAAGCACAGATAGAAGAGCTCCGTCAGAAAACACAGGAGGAAGGGGAGGAGCGGGCTGAGTCGGAGCAGGAGGCCTACCTGCGTGAGGATTGA
ORF Protein Sequence MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0216-Ab Anti-DIABLO monoclonal antibody
    Target Antigen GM-Tg-g-IP0216-Ag DIABLO protein
    ORF Viral Vector pGMLV000088 Human DIABLO Lentivirus plasmid
    ORF Viral Vector vGMLV000088 Human DIABLO Lentivirus particle


    Target information

    Target ID GM-IP0216
    Target Name DIABLO/Smac
    Gene Group Identifier
    (Target Gene ID in Homo species)
    56616
    Gene ID 100058709 (Equus caballus), 288753 (Rattus norvegicus), 477463 (Canis lupus familiaris), 493999 (Bos taurus)
    56616 (Homo sapiens), 66593 (Mus musculus), 701896 (Macaca mulatta), 768282 (Felis catus)
    Gene Symbols & Synonyms DIABLO,Diablo,Smac,DBO,SMAC,DFNA64,0610041G12Rik,1700006L01Rik
    Target Alternative Names 0610041G12Rik,1700006L01Rik,DBO,DFNA64,DIABLO,Diablo,Diablo IAP-binding mitochondrial protein,Diablo homolog,Direct IAP-binding protein with low pI,SMAC,Second mitochondria-derived activator of caspases (SMAC),Smac,mitochondrial
    Uniprot Accession Q9JIQ3,Q9NR28
    Additional SwissProt Accessions: Q9NR28,Q9JIQ3
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category
    Disease cancer
    Disease from KEGG Apoptosis, Apoptosis - multiple species
    Gene Ensembl ENSECAG00000020255, ENSCAFG00845022403, ENSBTAG00000004199, ENSG00000184047, ENSMUSG00000029433, ENSMMUG00000018037
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.