Human SPACA7/C13orf28 ORF/cDNA clone-Lentivirus plasmid (NM_145248.4)

Cat. No.: pGMLV000025
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SPACA7/C13orf28 Lentiviral expression plasmid for SPACA7 lentivirus packaging, SPACA7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to SPACA7/C13orf28 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $447
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV000025
Gene Name SPACA7
Accession Number NM_145248.4
Gene ID 122258
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 588 bp
Gene Alias C13orf28
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGTGAGCCAAGGAGACGGGACCCTCTGCTTTGTCCTCCTGCTGTGCTGTTGGCAAGAAACTGAGCTCCGGCCGAGAACCGTGATTCCAGGTTCACCTACTGAAATACCATTCAGTTCAAAACAGGAGGATATGTCTGAATTATTAGATGAAATTCTGGTCCAGGAGATTTTAGATCTGAATAAAACAACACCGAGCGAAATGCCAAGTACAGCATCAACATTATCAACACCGTTACATGCTGGTATTGATGAGAATTATCAAGCTGGTGGTTCTGAGAATTACCATGAATTATTAGAGAATTTACAATTCTCTCCTGGCATTGAGGTCAAAATTTCCAATGATGAAGCCAATGCTAATGCAAATCTCCATGGCGATCCTTCTGAGAATTATCGTGGGCCACAGGTGTCTCCTGGCAGTGAGAAGAGTGTTTCCAGTAAAGAAAAGAATTCAAAGAACACTCAGTATGAAAATCTATCCATTCTGGACCAAATCCTTCAAAATATTGGAAGATCTTCAGGAAACATTTTCCATAAAGAGCAGCAGAGGACCAGCGCACAGAGGAGGAGCCAAGGCAGTCAGTGA
ORF Protein Sequence MAVSQGDGTLCFVLLLCCWQETELRPRTVIPGSPTEIPFSSKQEDMSELLDEILVQEILDLNKTTPSEMPSTASTLSTPLHAGIDENYQAGGSENYHELLENLQFSPGIEVKISNDEANANANLHGDPSENYRGPQVSPGSEKSVSSKEKNSKNTQYENLSILDQILQNIGRSSGNIFHKEQQRTSAQRRSQGSQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1304-Ab Anti-SPAC7/ SPACA7/ C13orf28 functional antibody
    Target Antigen GM-Tg-g-SE1304-Ag SPACA7 protein
    ORF Viral Vector pGMLP003962 Human SPACA7 Lentivirus plasmid
    ORF Viral Vector pGMLV000025 Human SPACA7 Lentivirus plasmid
    ORF Viral Vector vGMLP003962 Human SPACA7 Lentivirus particle
    ORF Viral Vector vGMLV000025 Human SPACA7 Lentivirus particle


    Target information

    Target ID GM-SE1304
    Target Name SPACA7
    Gene Group Identifier
    (Target Gene ID in Homo species)
    122258
    Gene ID 102899981 (Felis catus), 106781882 (Equus caballus), 122258 (Homo sapiens), 689077 (Rattus norvegicus)
    695869 (Macaca mulatta), 781940 (Bos taurus), 78634 (Mus musculus)
    Gene Symbols & Synonyms SPACA7,Spaca7,C13orf28,1700094C09Rik
    Target Alternative Names SPACA7,Sperm acrosome-associated protein 7,C13orf28
    Uniprot Accession Q96KW9,Q9D2S4
    Additional SwissProt Accessions: Q96KW9,Q9D2S4
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSG00000153498, ENSMMUG00000013615, ENSBTAG00000054563, ENSMUSG00000010435
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.