Human RALA/RAL ORF/cDNA clone-Lentivirus plasmid (NM_005402.3)

Cat. No.: pGMLP005819
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RALA/RAL Lentiviral expression plasmid for RALA lentivirus packaging, RALA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RALA/RAL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $455.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005819
Gene Name RALA
Accession Number NM_005402.3
Gene ID 5898
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 621 bp
Gene Alias RAL
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCAAATAAGCCCAAGGGTCAGAATTCTTTGGCTTTACACAAAGTCATCATGGTGGGCAGTGGTGGCGTGGGCAAGTCAGCTCTGACTCTACAGTTCATGTACGATGAGTTTGTGGAGGACTATGAGCCTACCAAAGCAGACAGCTATCGGAAGAAGGTAGTGCTAGATGGGGAGGAAGTCCAGATCGATATCTTAGATACAGCTGGGCAGGAGGACTACGCTGCAATTAGAGACAACTACTTCCGAAGTGGGGAGGGGTTCCTCTGTGTTTTCTCTATTACAGAAATGGAATCCTTTGCAGCTACAGCTGACTTCAGGGAGCAGATTTTAAGAGTAAAAGAAGATGAGAATGTTCCATTTCTACTGGTTGGTAACAAATCAGATTTAGAAGATAAAAGACAGGTTTCTGTAGAAGAGGCAAAAAACAGAGCTGAGCAGTGGAATGTTAACTACGTGGAAACATCTGCTAAAACACGAGCTAATGTTGACAAGGTATTTTTTGATTTAATGAGAGAAATTCGAGCGAGAAAGATGGAAGACAGCAAAGAAAAGAATGGAAAAAAGAAGAGGAAAAGTTTAGCCAAGAGAATCAGAGAAAGATGCTGCATTTTATAA
ORF Protein Sequence MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2279-Ab Anti-RALA/ RAL monoclonal antibody
    Target Antigen GM-Tg-g-MP2279-Ag RALA VLP (virus-like particle)
    ORF Viral Vector pGMLP000857 Human RALA Lentivirus plasmid
    ORF Viral Vector pGMLP005654 Human RALA Lentivirus plasmid
    ORF Viral Vector pGMLP005819 Human RALA Lentivirus plasmid
    ORF Viral Vector vGMLP000857 Human RALA Lentivirus particle
    ORF Viral Vector vGMLP005654 Human RALA Lentivirus particle
    ORF Viral Vector vGMLP005819 Human RALA Lentivirus particle


    Target information

    Target ID GM-MP2279
    Target Name RALA
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5898
    Gene ID 100051360 (Equus caballus), 101091003 (Felis catus), 475875 (Canis lupus familiaris), 538477 (Bos taurus)
    56044 (Mus musculus), 5898 (Homo sapiens), 703440 (Macaca mulatta), 81757 (Rattus norvegicus)
    Gene Symbols & Synonyms RALA,Rala,Ral,Rasl1,3010001O15Rik,RAL,HINCONS
    Target Alternative Names RALA,Ras-related protein Ral-A,RAL,HINCONS
    Uniprot Accession P11233,P63321,P63322
    Additional SwissProt Accessions: P63321,P11233,P63322
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease cancer
    Disease from KEGG Ras signaling pathway, Rap1 signaling pathway, Phospholipase D signaling pathway, Pathways in cancer, Colorectal cancer, Pancreatic cancer
    Gene Ensembl ENSECAG00000017044, ENSCAFG00845019538, ENSBTAG00000006661, ENSMUSG00000008859, ENSG00000006451, ENSMMUG00000050621
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.