Human NRAS/ALPS4/CMNS ORF/cDNA clone-Lentivirus plasmid (NM_002524.4)
Cat. No.: pGMLP005786
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human NRAS/ALPS4/CMNS Lentiviral expression plasmid for NRAS lentivirus packaging, NRAS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
NRAS/ALPS4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP005786 |
| Gene Name | NRAS |
| Accession Number | NM_002524.4 |
| Gene ID | 4893 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 570 bp |
| Gene Alias | ALPS4,CMNS,N-ras,NCMS,NRAS1,NS6 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGACTGAGTACAAACTGGTGGTGGTTGGAGCAGGTGGTGTTGGGAAAAGCGCACTGACAATCCAGCTAATCCAGAACCACTTTGTAGATGAATATGATCCCACCATAGAGGATTCTTACAGAAAACAAGTGGTTATAGATGGTGAAACCTGTTTGTTGGACATACTGGATACAGCTGGACAAGAAGAGTACAGTGCCATGAGAGACCAATACATGAGGACAGGCGAAGGCTTCCTCTGTGTATTTGCCATCAATAATAGCAAGTCATTTGCGGATATTAACCTCTACAGGGAGCAGATTAAGCGAGTAAAAGACTCGGATGATGTACCTATGGTGCTAGTGGGAAACAAGTGTGATTTGCCAACAAGGACAGTTGATACAAAACAAGCCCACGAACTGGCCAAGAGTTACGGGATTCCATTCATTGAAACCTCAGCCAAGACCAGACAGGGTGTTGAAGATGCTTTTTACACACTGGTAAGAGAAATACGCCAGTACCGAATGAAAAAACTCAACAGCAGTGATGATGGGACTCAGGGTTGTATGGGATTGCCATGTGTGGTGATGTAA |
| ORF Protein Sequence | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T35486-Ab | Anti-NRAS monoclonal antibody |
| Target Antigen | GM-Tg-g-T35486-Ag | NRAS protein |
| ORF Viral Vector | pGMLP000874 | Human NRAS Lentivirus plasmid |
| ORF Viral Vector | pGMLP005597 | Human NRAS Lentivirus plasmid |
| ORF Viral Vector | pGMLP005783 | Human NRAS Lentivirus plasmid |
| ORF Viral Vector | pGMLP005784 | Human NRAS Lentivirus plasmid |
| ORF Viral Vector | pGMLP005785 | Human NRAS Lentivirus plasmid |
| ORF Viral Vector | pGMLP005786 | Human NRAS Lentivirus plasmid |
| ORF Viral Vector | pGMLP005787 | Human NRAS Lentivirus plasmid |
| ORF Viral Vector | pGMLP005788 | Human NRAS Lentivirus plasmid |
| ORF Viral Vector | pGMLP005789 | Human NRAS Lentivirus plasmid |
| ORF Viral Vector | pGMLP005790 | Human NRAS Lentivirus plasmid |
| ORF Viral Vector | pGMLP-SPh-053 | Human NRas Lentivirus plasmid |
| ORF Viral Vector | pGMAP-SPh-193 | Human NRas Adenovirus plasmid |
| ORF Viral Vector | vGMLP000874 | Human NRAS Lentivirus particle |
| ORF Viral Vector | vGMLP005597 | Human NRAS Lentivirus particle |
| ORF Viral Vector | vGMLP005783 | Human NRAS Lentivirus particle |
| ORF Viral Vector | vGMLP005784 | Human NRAS Lentivirus particle |
| ORF Viral Vector | vGMLP005785 | Human NRAS Lentivirus particle |
| ORF Viral Vector | vGMLP005786 | Human NRAS Lentivirus particle |
| ORF Viral Vector | vGMLP005787 | Human NRAS Lentivirus particle |
| ORF Viral Vector | vGMLP005788 | Human NRAS Lentivirus particle |
| ORF Viral Vector | vGMLP005789 | Human NRAS Lentivirus particle |
| ORF Viral Vector | vGMLP005790 | Human NRAS Lentivirus particle |
| ORF Viral Vector | vGMLP-SPh-053 | Human NRas Lentivirus particle |
| ORF Viral Vector | vGMAP-SPh-193 | Human NRas Adenovirus particle |
Target information
| Target ID | GM-T35486 |
| Target Name | NRAS |
|
Gene Group Identifier (Target Gene ID in Homo species) |
4893 |
| Gene ID |
100059469 (Equus caballus), 18176 (Mus musculus), 24605 (Rattus norvegicus), 403872 (Canis lupus familiaris) 4893 (Homo sapiens), 506322 (Bos taurus), 709089 (Macaca mulatta), 751105 (Felis catus) |
| Gene Symbols & Synonyms | NRAS,Nras,N-ras,N-RAS,rasp21,NS6,CMNS,KRAS,NCMS,ALPS4,NRAS1 |
| Target Alternative Names | ALPS4,CMNS,GTPase NRas,KRAS,N-RAS,N-ras,NCMS,NRAS,NRAS1,NS6,Nras,Transforming protein N-Ras,rasp21 |
| Uniprot Accession |
P01111,P08556,Q04970
Additional SwissProt Accessions: P08556,Q04970,P01111 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer, Non-Small Cell Lung Cancer, Colorectal Cancer, Malignant neoplasm of bladder |
| Disease from KEGG | EGFR tyrosine kinase inhibitor resistance, Endocrine resistance, MAPK signaling pathway, ErbB signaling pathway, Ras signaling pathway, Rap1 signaling pathway, Chemokine signaling pathway, FoxO signaling pathway, Sphingolipid signaling pathway, Phospholipase D signaling pathway, PI3K-Akt signaling pathway, Apoptosis, Longevity regulating pathway, Longevity regulating pathway - multiple species, Cellular senescence, Axon guidance, Gap junction, Signaling pathways regulating pluripotency of stem cells, C-type lectin receptor signaling pathway, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Long-term potentiation, Neurotrophin signaling pathway, Cholinergic synapse, Serotonergic synapse, Regulation of actin cytoskeleton, GnRH signaling pathway, Melanogenesis, Prolactin signaling pathway, Thyroid hormone signaling pathway, Oxytocin signaling pathway, Relaxin signaling pathway, GnRH secretion, AGE-RAGE signaling pathway in diabetic complications, Growth hormone synthesis, secretion and action, Alzheimer disease, Hepatitis C, Hepatitis B, Human cytomegalovirus infection, Human papillomavirus infection, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Proteoglycans in cancer, Chemical carcinogenesis - receptor activation, Colorectal cancer, Renal cell carcinoma, Endometrial cancer, Glioma, Prostate cancer, Thyroid cancer, Melanoma, Bladder cancer, Chronic myeloid leukemia, Acute myeloid leukemia, Non-small cell lung cancer, Breast cancer, Hepatocellular carcinoma, Gastric cancer, Central carbon metabolism in cancer, Choline metabolism in cancer, PD-L1 expression and PD-1 checkpoint pathway in cancer, Lipid and atherosclerosis |
| Gene Ensembl | ENSECAG00000013942, ENSMUSG00000027852, ENSCAFG00845026380, ENSG00000213281, ENSBTAG00000046797, ENSMMUG00000049105 |
| Target Classification |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


