Human PRKAG1/AMPKG ORF/cDNA clone-Lentivirus plasmid (NM_002733.4)

Cat. No.: pGMLP005646
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PRKAG1/AMPKG Lentiviral expression plasmid for PRKAG1 lentivirus packaging, PRKAG1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to AMPK Gamma 1/PRKAG1/PRKAG1/AMPKG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $549
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005646
Gene Name PRKAG1
Accession Number NM_002733.4
Gene ID 5571
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 996 bp
Gene Alias AMPKG
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGACGGTCATTTCTTCAGATAGCTCCCCAGCTGTGGAAAATGAGCATCCTCAAGAGACCCCAGAATCCAACAATAGCGTGTATACTTCCTTCATGAAGTCTCATCGCTGCTATGACCTGATTCCCACAAGCTCCAAATTGGTTGTATTTGATACGTCCCTGCAGGTGAAGAAAGCTTTTTTTGCTTTGGTGACTAACGGTGTACGAGCTGCCCCTTTATGGGATAGTAAGAAGCAAAGTTTTGTGGGCATGCTGACCATCACTGATTTCATCAATATCCTGCACCGCTACTATAAATCAGCCTTGGTACAGATCTATGAGCTAGAAGAACACAAGATAGAAACTTGGAGAGAGGTGTATCTCCAGGACTCCTTTAAACCGCTTGTCTGCATTTCTCCTAATGCCAGCTTGTTTGATGCTGTCTCTTCATTAATTCGGAACAAGATCCACAGGCTGCCAGTTATTGACCCAGAATCAGGCAATACTTTGTACATCCTCACCCACAAGCGCATTCTGAAGTTCCTCAAATTGTTTATCACTGAGTTCCCCAAGCCAGAGTTCATGTCCAAGTCTCTGGAAGAGCTACAGATTGGCACCTATGCCAATATTGCTATGGTTCGCACTACCACCCCCGTCTATGTGGCTCTGGGGATTTTTGTACAGCATCGAGTCTCAGCCCTGCCAGTGGTGGATGAGAAGGGGCGTGTGGTGGACATCTACTCCAAGTTTGATGTTATCAATCTGGCAGCAGAAAAGACCTACAACAACCTAGATGTATCTGTGACTAAAGCCTTGCAACATCGATCACATTACTTTGAGGGTGTTCTCAAGTGCTACCTGCATGAGACTCTGGAGACCATCATCAACAGGCTAGTGGAAGCAGAGGTTCACCGACTTGTAGTGGTGGATGAAAATGATGTGGTCAAGGGAATTGTATCACTGTCTGACATCCTGCAGGCCCTGGTGCTCACAGGTGGAGAGAAGAAGCCCTGA
ORF Protein Sequence METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA151-Ab Anti-PRKAG1 monoclonal antibody
    Target Antigen GM-Tg-g-TA151-Ag PRKAG1 protein
    ORF Viral Vector pGMLP005400 Human PRKAG1 Lentivirus plasmid
    ORF Viral Vector pGMLP005646 Human PRKAG1 Lentivirus plasmid
    ORF Viral Vector vGMLP005400 Human PRKAG1 Lentivirus particle
    ORF Viral Vector vGMLP005646 Human PRKAG1 Lentivirus particle


    Target information

    Target ID GM-TA151
    Target Name AMPK Gamma 1/PRKAG1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    5571
    Gene ID 100034096 (Equus caballus), 101094684 (Felis catus), 19082 (Mus musculus), 25520 (Rattus norvegicus)
    282324 (Bos taurus), 486559 (Canis lupus familiaris), 5571 (Homo sapiens), 709298 (Macaca mulatta)
    Gene Symbols & Synonyms PRKAG1,Prkag1,Prkaac,Prkga1,AMPKG
    Target Alternative Names 5'-AMP-activated protein kinase subunit gamma-1,AMPK Gamma 1,AMPK gamma1,AMPK subunit gamma-1,AMPKG,AMPKg,PRKAG1,Prkaac,Prkag1,Prkga1
    Uniprot Accession O54950,P54619,P58108,P80385
    Additional SwissProt Accessions: O54950,P80385,P58108,P54619
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease
    Disease from KEGG FoxO signaling pathway, Longevity regulating pathway, Longevity regulating pathway - multiple species, Tight junction, Adipocytokine signaling pathway, Oxytocin signaling pathway, Insulin resistance, Alcoholic liver disease, Hypertrophic cardiomyopathy
    Gene Ensembl ENSECAG00000011134, ENSMUSG00000067713, ENSBTAG00000014426, ENSCAFG00845022388, ENSG00000181929, ENSMMUG00000015713
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.