Human PPP1CA/PP-1A/PP1A ORF/cDNA clone-Lentivirus plasmid (NM_002708.3)
Cat. No.: pGMLP005601
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human PPP1CA/PP-1A/PP1A Lentiviral expression plasmid for PPP1CA lentivirus packaging, PPP1CA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
PPP1CA/PP-1A products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP005601 |
Gene Name | PPP1CA |
Accession Number | NM_002708.3 |
Gene ID | 5499 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 993 bp |
Gene Alias | PP-1A,PP1A,PP1alpha,PPP1A |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTCCGACAGCGAGAAGCTCAACCTGGACTCGATCATCGGGCGCCTGCTGGAAGTGCAGGGCTCGCGGCCTGGCAAGAATGTACAGCTGACAGAGAACGAGATCCGCGGTCTGTGCCTGAAATCCCGGGAGATTTTTCTGAGCCAGCCCATTCTTCTGGAGCTGGAGGCACCCCTCAAGATCTGCGGTGACATACACGGCCAGTACTACGACCTTCTGCGACTATTTGAGTATGGCGGTTTCCCTCCCGAGAGCAACTACCTCTTTCTGGGGGACTATGTGGACAGGGGCAAGCAGTCCTTGGAGACCATCTGCCTGCTGCTGGCCTATAAGATCAAGTACCCCGAGAACTTCTTCCTGCTCCGTGGGAACCACGAGTGTGCCAGCATCAACCGCATCTATGGTTTCTACGATGAGTGCAAGAGACGCTACAACATCAAACTGTGGAAAACCTTCACTGACTGCTTCAACTGCCTGCCCATCGCGGCCATAGTGGACGAAAAGATCTTCTGCTGCCACGGAGGCCTGTCCCCGGACCTGCAGTCTATGGAGCAGATTCGGCGGATCATGCGGCCCACAGATGTGCCTGACCAGGGCCTGCTGTGTGACCTGCTGTGGTCTGACCCTGACAAGGACGTGCAGGGCTGGGGCGAGAACGACCGTGGCGTCTCTTTTACCTTTGGAGCCGAGGTGGTGGCCAAGTTCCTCCACAAGCACGACTTGGACCTCATCTGCCGAGCACACCAGGTGGTAGAAGACGGCTACGAGTTCTTTGCCAAGCGGCAGCTGGTGACACTTTTCTCAGCTCCCAACTACTGTGGCGAGTTTGACAATGCTGGCGCCATGATGAGTGTGGACGAGACCCTCATGTGCTCTTTCCAGATCCTCAAGCCCGCCGACAAGAACAAGGGGAAGTACGGGCAGTTCAGTGGCCTGAACCCTGGAGGCCGACCCATCACCCCACCCCGCAATTCCGCCAAAGCCAAGAAATAG |
ORF Protein Sequence | MSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T59845-Ab | Anti-PP1A/ PPP1CA/ PP-1A monoclonal antibody |
Target Antigen | GM-Tg-g-T59845-Ag | PPP1CA VLP (virus-like particle) |
ORF Viral Vector | pGMLP000473 | Human PPP1CA Lentivirus plasmid |
ORF Viral Vector | pGMLP005601 | Human PPP1CA Lentivirus plasmid |
ORF Viral Vector | pGMAP000389 | Human PPP1CA Adenovirus plasmid |
ORF Viral Vector | pGMPC000448 | Human PPP1CA Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP000473 | Human PPP1CA Lentivirus particle |
ORF Viral Vector | vGMLP005601 | Human PPP1CA Lentivirus particle |
ORF Viral Vector | vGMAP000389 | Human PPP1CA Adenovirus particle |
Target information
Target ID | GM-T59845 |
Target Name | PPP1CA |
Gene Group Identifier (Target Gene ID in Homo species) |
5499 |
Gene ID |
100059233 (Equus caballus), 109492306 (Felis catus), 19045 (Mus musculus), 24668 (Rattus norvegicus) 403609 (Canis lupus familiaris), 516175 (Bos taurus), 5499 (Homo sapiens), 721735 (Macaca mulatta) |
Gene Symbols & Synonyms | PPP1CA,Ppp1ca,Ppp1c,dism2,PP1alpha,PP1A,PP-1A,PPP1A |
Target Alternative Names | PPP1CA,Serine/threonine-protein phosphatase PP1-alpha catalytic subunit,PP-1A,PP1A,PP-1A,PPP1A,PP1alpha |
Uniprot Accession |
P62136,P62137,P62138,Q3T0E7,Q8WMS6
Additional SwissProt Accessions: P62137,P62138,Q8WMS6,Q3T0E7,P62136 |
Uniprot Entry Name | |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | |
Disease from KEGG | cGMP-PKG signaling pathway, cAMP signaling pathway, Cellular senescence, Adrenergic signaling in cardiomyocytes, Vascular smooth muscle contraction, Hippo signaling pathway, Focal adhesion, Platelet activation, Long-term potentiation, Inflammatory mediator regulation of TRP channels, Regulation of actin cytoskeleton, Oxytocin signaling pathway, Insulin resistance, Amphetamine addiction, Proteoglycans in cancer |
Gene Ensembl | ENSECAG00000010532, ENSMUSG00000040385, ENSCAFG00845010538, ENSBTAG00000012146, ENSG00000172531, ENSMMUG00000017278 |
Target Classification | Kinase |
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.