Human FOS/AP-1/C-FOS ORF/cDNA clone-Lentivirus plasmid (NM_005252.3)
Cat. No.: pGMLP005582
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human FOS/AP-1/C-FOS Lentiviral expression plasmid for FOS lentivirus packaging, FOS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
c-Fos/FOS/FOS/AP-1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP005582 |
| Gene Name | FOS |
| Accession Number | NM_005252.3 |
| Gene ID | 2353 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 1143 bp |
| Gene Alias | AP-1,C-FOS,p55 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGATGTTCTCGGGCTTCAACGCAGACTACGAGGCGTCATCCTCCCGCTGCAGCAGCGCGTCCCCGGCCGGGGATAGCCTCTCTTACTACCACTCACCCGCAGACTCCTTCTCCAGCATGGGCTCGCCTGTCAACGCGCAGGACTTCTGCACGGACCTGGCCGTCTCCAGTGCCAACTTCATTCCCACGGTCACTGCCATCTCGACCAGTCCGGACCTGCAGTGGCTGGTGCAGCCCGCCCTCGTCTCCTCCGTGGCCCCATCGCAGACCAGAGCCCCTCACCCTTTCGGAGTCCCCGCCCCCTCCGCTGGGGCTTACTCCAGGGCTGGCGTTGTGAAGACCATGACAGGAGGCCGAGCGCAGAGCATTGGCAGGAGGGGCAAGGTGGAACAGTTATCTCCAGAAGAAGAAGAGAAAAGGAGAATCCGAAGGGAAAGGAATAAGATGGCTGCAGCCAAATGCCGCAACCGGAGGAGGGAGCTGACTGATACACTCCAAGCGGAGACAGACCAACTAGAAGATGAGAAGTCTGCTTTGCAGACCGAGATTGCCAACCTGCTGAAGGAGAAGGAAAAACTAGAGTTCATCCTGGCAGCTCACCGACCTGCCTGCAAGATCCCTGATGACCTGGGCTTCCCAGAAGAGATGTCTGTGGCTTCCCTTGATCTGACTGGGGGCCTGCCAGAGGTTGCCACCCCGGAGTCTGAGGAGGCCTTCACCCTGCCTCTCCTCAATGACCCTGAGCCCAAGCCCTCAGTGGAACCTGTCAAGAGCATCAGCAGCATGGAGCTGAAGACCGAGCCCTTTGATGACTTCCTGTTCCCAGCATCATCCAGGCCCAGTGGCTCTGAGACAGCCCGCTCCGTGCCAGACATGGACCTATCTGGGTCCTTCTATGCAGCAGACTGGGAGCCTCTGCACAGTGGCTCCCTGGGGATGGGGCCCATGGCCACAGAGCTGGAGCCCCTGTGCACTCCGGTGGTCACCTGTACTCCCAGCTGCACTGCTTACACGTCTTCCTTCGTCTTCACCTACCCCGAGGCTGACTCCTTCCCCAGCTGTGCAGCTGCCCACCGCAAGGGCAGCAGCAGCAATGAGCCTTCCTCTGACTCGCTCAGCTCACCCACGCTGCTGGCCCTGTGA |
| ORF Protein Sequence | MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T28025-Ab | Anti-c-Fos monoclonal antibody |
| Target Antigen | GM-Tg-g-T28025-Ag | c-Fos/FOS protein |
| ORF Viral Vector | pGMLP001940 | Human FOS Lentivirus plasmid |
| ORF Viral Vector | pGMLP005582 | Human FOS Lentivirus plasmid |
| ORF Viral Vector | pGMAD000494 | Human FOS Adenovirus plasmid |
| ORF Viral Vector | pGMAD001430 | Human FOS Adenovirus plasmid |
| ORF Viral Vector | pGMAP000475 | Human FOS Adenovirus plasmid |
| ORF Viral Vector | vGMLP001940 | Human FOS Lentivirus particle |
| ORF Viral Vector | vGMLP005582 | Human FOS Lentivirus particle |
| ORF Viral Vector | vGMAD000494 | Human FOS Adenovirus particle |
| ORF Viral Vector | vGMAD001430 | Human FOS Adenovirus particle |
| ORF Viral Vector | vGMAP000475 | Human FOS Adenovirus particle |
Target information
| Target ID | GM-T28025 |
| Target Name | c-Fos/FOS |
|
Gene Group Identifier (Target Gene ID in Homo species) |
2353 |
| Gene ID |
100051632 (Equus caballus), 14281 (Mus musculus), 2353 (Homo sapiens), 280795 (Bos taurus) 314322 (Rattus norvegicus), 490792 (Canis lupus familiaris), 493935 (Felis catus), 702077 (Macaca mulatta) |
| Gene Symbols & Synonyms | FOS,Fos,cFos,c-fos,D12Rfj1,p55,AP-1,C-FOS |
| Target Alternative Names | AP-1,AP-1 transcription factor subunit,C-FOS,Cellular oncogene fos,D12Rfj1,FOS,Fos,Fos proto-oncogene,G0/G1 switch regulatory protein 7,Protein c-Fos,Proto-oncogene c-Fos,Transcription factor AP-1 subunit c-Fos,c-Fos,c-fos,cFos,p55 |
| Uniprot Accession |
O77628,P01100,P01101,P12841,Q8HZP6
Additional SwissProt Accessions: P01101,P01100,O77628,P12841,Q8HZP6 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | cancer |
| Disease from KEGG | Endocrine resistance, MAPK signaling pathway, cAMP signaling pathway, Apoptosis, Osteoclast differentiation, Toll-like receptor signaling pathway, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, B cell receptor signaling pathway, TNF signaling pathway, Circadian entrainment, Cholinergic synapse, Prolactin signaling pathway, Oxytocin signaling pathway, Relaxin signaling pathway, Parathyroid hormone synthesis, secretion and action, Growth hormone synthesis, secretion and action, Amphetamine addiction, Pathogenic Escherichia coli infection, Pertussis, Yersinia infection, Leishmaniasis, Chagas disease, Hepatitis B, Measles, Human T-cell leukemia virus 1 infection, Kaposi sarcoma-associated herpesvirus infection, Pathways in cancer, Chemical carcinogenesis - receptor activation, Colorectal cancer, Breast cancer, Choline metabolism in cancer, PD-L1 expression and PD-1 checkpoint pathway in cancer, Rheumatoid arthritis, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSECAG00000014260, ENSMUSG00000021250, ENSG00000170345, ENSBTAG00000004322, ENSCAFG00845015304, ENSMMUG00000040100 |
| Target Classification | Tumor-associated antigen (TAA) |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


