Human NME3/c371H6.2/DR-nm23 ORF/cDNA clone-Lentivirus plasmid (NM_002513.2)

Cat. No.: pGMLP005518
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NME3/c371H6.2/DR-nm23 Lentiviral expression plasmid for NME3 lentivirus packaging, NME3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to NME3/c371H6.2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $427.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005518
Gene Name NME3
Accession Number NM_002513.2
Gene ID 4832
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 510 bp
Gene Alias c371H6.2,DR-nm23,NDPK-C,NDPKC,NM23-H3,NM23H3
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATCTGCCTGGTGCTGACCATCTTCGCTAACCTCTTCCCCGCGGCCTGCACCGGCGCACACGAACGCACCTTCCTGGCCGTGAAGCCGGACGGCGTGCAGCGGCGGCTGGTGGGCGAGATTGTGCGGCGCTTCGAGAGGAAGGGCTTCAAGTTGGTGGCGCTGAAGCTGGTGCAGGCCTCCGAGGAGCTGCTGCGTGAGCACTACGCCGAGCTGCGTGAACGCCCGTTCTACGGCCGCCTTGTCAAGTATATGGCCTCCGGGCCGGTGGTGGCCATGGTATGGCAGGGGCTGGACGTGGTGCGCACCTCGCGGGCGCTCATCGGAGCCACGAACCCGGCCGACGCCCCGCCCGGCACCATCCGCGGGGATTTCTGCATCGAGGTTGGCAAGAACCTGATTCACGGCAGCGACTCGGTGGAGAGTGCCCGCCGCGAGATCGCTCTCTGGTTCCGCGCAGACGAGCTCCTCTGCTGGGAGGACAGCGCTGGGCACTGGCTGTATGAGTAG
ORF Protein Sequence MICLVLTIFANLFPAACTGAHERTFLAVKPDGVQRRLVGEIVRRFERKGFKLVALKLVQASEELLREHYAELRERPFYGRLVKYMASGPVVAMVWQGLDVVRTSRALIGATNPADAPPGTIRGDFCIEVGKNLIHGSDSVESARREIALWFRADELLCWEDSAGHWLYE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1445-Ab Anti-NDK3/ NME3/ DR-nm23 functional antibody
    Target Antigen GM-Tg-g-SE1445-Ag NME3 protein
    ORF Viral Vector pGMLP005518 Human NME3 Lentivirus plasmid
    ORF Viral Vector vGMLP005518 Human NME3 Lentivirus particle


    Target information

    Target ID GM-SE1445
    Target Name NME3
    Gene Group Identifier
    （Target Gene ID in Homo species)         		4832
    Gene ID 100856596 (Canis lupus familiaris), 111558223 (Felis catus), 111767590 (Equus caballus), 4832 (Homo sapiens)
    515663 (Bos taurus), 722479 (Macaca mulatta), 79059 (Mus musculus), 85269 (Rattus norvegicus)
    Gene Symbols & Synonyms NME3,Nme3,NDPKC,NDPK-C,NM23H3,DR-nm23,NM23-H3,c371H6.2,Ndk3,Nm23-DR,Nm23-M3,1810009F08Rik,NM23-dr
    Target Alternative Names 1810009F08Rik,DR-nm23,NDK 3,NDP kinase 3,NDPK-C,NDPKC,NM23-H3,NM23-dr,NM23H3,NME3,Ndk3,Nm23-DR,Nm23-M3,Nme3,Nucleoside diphosphate kinase 3,Nucleoside diphosphate kinase C (NDPKC),c371H6.2,nm23-H3
    Uniprot Accession Q13232,Q9WV85
    Additional SwissProt Accessions: Q13232,Q9WV85
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Metabolic pathways
    Gene Ensembl ENSECAG00000038477, ENSG00000103024, ENSBTAG00000016552, ENSMUSG00000073435
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.