Human MAPK12/ERK-6/ERK3 ORF/cDNA clone-Lentivirus plasmid (NM_002969.5)
Cat. No.: pGMLP005401
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human MAPK12/ERK-6/ERK3 Lentiviral expression plasmid for MAPK12 lentivirus packaging, MAPK12 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
MAPK12/ERK-6 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLP005401 |
| Gene Name | MAPK12 |
| Accession Number | NM_002969.5 |
| Gene ID | 6300 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 1104 bp |
| Gene Alias | ERK-6,ERK3,ERK6,MAPK 12,P38GAMMA,PRKM12,SAPK-3,SAPK3 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGCTCTCCGCCGCCCGCCCGCAGTGGCTTTTACCGCCAGGAGGTGACCAAGACGGCCTGGGAGGTGCGCGCCGTGTACCGGGACCTGCAGCCCGTGGGCTCGGGCGCCTACGGCGCGGTGTGCTCGGCCGTGGACGGCCGCACCGGCGCTAAGGTGGCCATCAAGAAGCTGTATCGGCCTTTCCAGTCCGAGCTGTTCGCCAAGCGCGCCTACCGCGAGCTGCGCCTGCTCAAGCACATGCGCCACGAGAACGTGATCGGGCTGCTGGACGTATTCACTCCTGATGAGACCCTGGATGACTTCACGGACTTTTACCTGGTGATGCCGTTCATGGGCACCGACCTGGGCAAGCTCATGAAACATGAGAAGCTAGGCGAGGACCGGATCCAGTTCCTCGTGTACCAGATGCTGAAGGGGCTGAGGTATATCCACGCTGCCGGCATCATCCACAGAGACCTGAAGCCCGGCAACCTGGCTGTGAACGAAGACTGTGAGCTGAAGATCCTGGACTTCGGCCTGGCCAGGCAGGCAGACAGTGAGATGACTGGGTACGTGGTGACCCGGTGGTACCGGGCTCCCGAGGTCATCTTGAATTGGATGCGCTACACGCAGACGGTGGACATCTGGTCTGTGGGCTGCATCATGGCGGAGATGATCACAGGCAAGACGCTGTTCAAGGGCAGCGACCACCTGGACCAGCTGAAGGAGATCATGAAGGTGACGGGGACGCCTCCGGCTGAGTTTGTGCAGCGGCTGCAGAGCGATGAGGCCAAGAACTACATGAAGGGCCTCCCCGAATTGGAGAAGAAGGATTTTGCCTCTATCCTGACCAATGCAAGCCCTCTGGCTGTGAACCTCCTGGAGAAGATGCTGGTGCTGGACGCGGAGCAGCGGGTGACGGCAGGCGAGGCGCTGGCCCATCCCTACTTCGAGTCCCTGCACGACACGGAAGATGAGCCCCAGGTCCAGAAGTATGATGACTCCTTTGACGACGTTGACCGCACACTGGATGAATGGAAGCGTGTTACTTACAAAGAGGTGCTCAGCTTCAAGCCTCCCCGGCAGCTGGGGGCCAGGGTCTCCAAGGAGACGCCTCTGTGA |
| ORF Protein Sequence | MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T79798-Ab | Anti-MAPK12 monoclonal antibody |
| Target Antigen | GM-Tg-g-T79798-Ag | MAPK12 protein |
| ORF Viral Vector | pGMLP005401 | Human MAPK12 Lentivirus plasmid |
| ORF Viral Vector | pGMPC001119 | Human MAPK12 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP005401 | Human MAPK12 Lentivirus particle |
Target information
| Target ID | GM-T79798 |
| Target Name | MAPK12 |
|
Gene Group Identifier (Target Gene ID in Homo species) |
6300 |
| Gene ID |
100056239 (Equus caballus), 111556320 (Felis catus), 29857 (Mus musculus), 512943 (Bos taurus) 60352 (Rattus norvegicus), 607023 (Canis lupus familiaris), 6300 (Homo sapiens), 715745 (Macaca mulatta) |
| Gene Symbols & Synonyms | MAPK12,Mapk12,Erk6,Sapk3,Prkm12,P38gamma,ERK3,ERK6,ERK-6,SAPK3,PRKM12,SAPK-3,MAPK 12,P38GAMMA |
| Target Alternative Names | ERK-6,ERK3,ERK6,Erk6,Extracellular signal-regulated kinase 6 (ERK-6),MAP kinase 12,MAPK 12,MAPK12,Mapk12,Mitogen-activated protein kinase 12,Mitogen-activated protein kinase p38 gamma (MAP kinase p38 gamma),P38GAMMA,P38gamma,PRKM12,Prkm12,SAPK-3,SAPK3,Sapk3,Stress-activated protein kinase 3 |
| Uniprot Accession |
O08911,P53778,Q63538
Additional SwissProt Accessions: O08911,Q63538,P53778 |
| Uniprot Entry Name | |
| Protein Sub-location | Introcelluar Protein |
| Category | Therapeutics Target |
| Disease | |
| Disease from KEGG | Endocrine resistance, MAPK signaling pathway, Rap1 signaling pathway, FoxO signaling pathway, Sphingolipid signaling pathway, Cellular senescence, Adrenergic signaling in cardiomyocytes, Osteoclast differentiation, Signaling pathways regulating pluripotency of stem cells, Platelet activation, Toll-like receptor signaling pathway, NOD-like receptor signaling pathway, RIG-I-like receptor signaling pathway, C-type lectin receptor signaling pathway, IL-17 signaling pathway, Th1 and Th2 cell differentiation, Th17 cell differentiation, T cell receptor signaling pathway, Fc epsilon RI signaling pathway, TNF signaling pathway, Leukocyte transendothelial migration, Neurotrophin signaling pathway, Inflammatory mediator regulation of TRP channels, GnRH signaling pathway, Prolactin signaling pathway, Relaxin signaling pathway, AGE-RAGE signaling pathway in diabetic complications, Growth hormone synthesis, secretion and action, Alcoholic liver disease, Epithelial cell signaling in Helicobacter pylori infection, Pathogenic Escherichia coli infection, Pertussis, Yersinia infection, Leishmaniasis, Chagas disease, Toxoplasmosis, Tuberculosis, Hepatitis B, Human cytomegalovirus infection, Kaposi sarcoma-associated herpesvirus infection, Epstein-Barr virus infection, Proteoglycans in cancer, PD-L1 expression and PD-1 checkpoint pathway in cancer, Lipid and atherosclerosis, Fluid shear stress and atherosclerosis |
| Gene Ensembl | ENSMUSG00000022610, ENSBTAG00000019574, ENSCAFG00845005996, ENSG00000188130 |
| Target Classification | Kinase |
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


