Human NPM1/B23/NPM ORF/cDNA clone-Lentivirus plasmid (NM_002520.7)

Cat. No.: pGMLP005179
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NPM1/B23/NPM Lentiviral expression plasmid for NPM1 lentivirus packaging, NPM1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to B23/NPM1/NPM1/B23 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $499.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005179
Gene Name NPM1
Accession Number NM_002520.7
Gene ID 4869
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 798 bp
Gene Alias B23,NPM
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAAGATTCGATGGACATGGACATGAGCCCCCTGAGGCCCCAGAACTATCTTTTCGGTTGTGAACTAAAGGCCGACAAAGATTATCACTTTAAGGTGGATAATGATGAAAATGAGCACCAGTTATCTTTAAGAACGGTCAGTTTAGGGGCTGGTGCAAAGGATGAGTTGCACATTGTTGAAGCAGAGGCAATGAATTACGAAGGCAGTCCAATTAAAGTAACACTGGCAACTTTGAAAATGTCTGTACAGCCAACGGTTTCCCTTGGGGGCTTTGAAATAACACCACCAGTGGTCTTAAGGTTGAAGTGTGGTTCAGGGCCAGTGCATATTAGTGGACAGCACTTAGTAGCTGTGGAGGAAGATGCAGAGTCAGAAGATGAAGAGGAGGAGGATGTGAAACTCTTAAGTATATCTGGAAAGCGGTCTGCCCCTGGAGGTGGTAGCAAGGTTCCACAGAAAAAAGTAAAACTTGCTGCTGATGAAGATGATGACGATGATGATGAAGAGGATGATGATGAAGATGATGATGATGATGATTTTGATGATGAGGAAGCTGAAGAAAAAGCGCCAGTGAAGAAATCTATACGAGATACTCCAGCCAAAAATGCACAAAAGTCAAATCAGAATGGAAAAGACTCAAAACCATCATCAACACCAAGATCAAAAGGACAAGAATCCTTCAAGAAACAGGAAAAAACTCCTAAAACACCAAAAGGACCTAGTTCTGTAGAAGACATTAAAGCAAAAATGCAAGCAAGTATAGAAAAAGGTGGTTCTCTTCCCAAAGTGGAAGCCAAATTCATCAATTATGTGAAGAATTGCTTCCGGATGACTGACCAAGAGGCTATTCAAGATCTCTGGCAGTGGAGGAAGTCTCTTTAA
ORF Protein Sequence MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T45591-Ab Anti-NPM1 monoclonal antibody
    Target Antigen GM-Tg-g-T45591-Ag NPM1 protein
    ORF Viral Vector pGMLP000923 Human NPM1 Lentivirus plasmid
    ORF Viral Vector pGMLP005179 Human NPM1 Lentivirus plasmid
    ORF Viral Vector pGMAP000021 Human NPM1 Adenovirus plasmid
    ORF Viral Vector pGMAP000065 Human NPM1 Adenovirus plasmid
    ORF Viral Vector pGMAP000113 Human NPM1 Adenovirus plasmid
    ORF Viral Vector pGMAP000237 Human NPM1 Adenovirus plasmid
    ORF Viral Vector vGMLP000923 Human NPM1 Lentivirus particle
    ORF Viral Vector vGMLP005179 Human NPM1 Lentivirus particle
    ORF Viral Vector vGMAP000021 Human NPM1 Adenovirus particle
    ORF Viral Vector vGMAP000065 Human NPM1 Adenovirus particle
    ORF Viral Vector vGMAP000113 Human NPM1 Adenovirus particle
    ORF Viral Vector vGMAP000237 Human NPM1 Adenovirus particle


    Target information

    Target ID GM-T45591
    Target Name B23/NPM1
    Gene Group Identifier
    (Target Gene ID in Homo species)
    4869
    Gene ID 100059112 (Equus caballus), 101094904 (Felis catus), 18148 (Mus musculus), 25498 (Rattus norvegicus)
    479292 (Canis lupus familiaris), 4869 (Homo sapiens), 614028 (Bos taurus), 706883 (Macaca mulatta)
    Gene Symbols & Synonyms NPM1,Npm1,B23,Npm,NO38,B23NP,NPM
    Target Alternative Names B23,B23NP,NO38,NPM,NPM1,Npm,Npm1,Nucleolar phosphoprotein B23,Nucleolar protein NO38,Nucleophosmin,Numatrin
    Uniprot Accession P06748,P13084,Q3T160,Q61937
    Additional SwissProt Accessions: Q61937,P13084,P06748,Q3T160
    Uniprot Entry Name
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease cancer
    Disease from KEGG
    Gene Ensembl ENSECAG00000021950, ENSMUSG00000057113, ENSCAFG00845001853, ENSG00000181163, ENSBTAG00000015316, ENSMMUG00000015781
    Target Classification Tumor-associated antigen (TAA)


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.