Human PRH1/Db-s/PA ORF/cDNA clone-Lentivirus plasmid (NM_001291315)

Cat. No.: pGMLP005150
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PRH1/Db-s/PA Lentiviral expression plasmid for PRH1 lentivirus packaging, PRH1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PRH2/PRH1/Db-s products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005150
Gene Name PRH1
Accession Number NM_001291315
Gene ID 5554
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 603 bp
Gene Alias Db-s,PA,PIF-S,Pr1/Pr2,PRH2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGAGGGGAATAGACTCCATCTATCCATATGAGCTGCTGCAGAAGAATATTTTGCCTGCTGGAACCTGCTGTATCTACTCAAGAGTGGAAGTTTTCACAGATGTCAGCCAGGAAGATGTTCCCCTCGTAATATCAGATGGAGGAGACTCTGAGCAGTTCCTAGATGAGGAGCGTCAGGGACCACCTTTGGGAGGACAGCAATCTCAACCCTCTGCTGGTGATGGGAACCAGGATGATGGCCCTCAGCAGGGACCACCCCAACAAGGAGGCCAGCAGCAACAAGGTCCACCACCTCCTCAGGGAAAGCCACAAGGACCACCCCAACAAGGAGGCCAGCAGCAACAAGGTCCACCACCTCCTCAGGGAAAGCCACAAGGACCACCCCAACAGGGAGGCCATCCCCCTCCTCCTCAAGGAAGGCCACAAGGACCACCCCAACAGGGAGGCCATCCCCGTCCTCCTCGAGGAAGGCCACAAGGACCACCCCAACAGGGAGGCCATCAGCAAGGTCCTCCCCCACCTCCTCCTGGAAAGCCCCAGGGACCACCTCCCCAAGGGGGCCGCCCACAAGGACCTCCACAGGGGCAGTCTCCTCAGTAA
ORF Protein Sequence MWRGIDSIYPYELLQKNILPAGTCCIYSRVEVFTDVSQEDVPLVISDGGDSEQFLDEERQGPPLGGQQSQPSAGDGNQDDGPQQGPPQQGGQQQQGPPPPQGKPQGPPQQGGQQQQGPPPPQGKPQGPPQQGGHPPPPQGRPQGPPQQGGHPRPPRGRPQGPPQQGGHQQGPPPPPPGKPQGPPPQGGRPQGPPQGQSPQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1205-Ab Anti-PRPC/ PRH2/ PRP-1/PRP-2 functional antibody
    Target Antigen GM-Tg-g-SE1205-Ag PRH2 protein
    ORF Viral Vector pGMLP005150 Human PRH1 Lentivirus plasmid
    ORF Viral Vector vGMLP005150 Human PRH1 Lentivirus particle


    Target information

    Target ID GM-SE1205
    Target Name PRH2
    Gene Group Identifier
    （Target Gene ID in Homo species)         		5555
    Gene ID 5555 (Homo sapiens)
    Gene Symbols & Synonyms PRH2,Pr,pr1/Pr2,PRP-1/PRP-2
    Target Alternative Names Db-s,PRH2,PRP-1/PRP-2,Parotid acidic protein (Pa),Parotid double-band protein,Parotid isoelectric focusing variant protein (PIF-S),Parotid proline-rich protein 1/2,Pr,Pr1/Pr2,Protein C,Salivary acidic proline-rich phosphoprotein 1/2,pr1/Pr2
    Uniprot Accession P02810
    Additional SwissProt Accessions: P02810
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category
    Disease
    Disease from KEGG Salivary secretion
    Gene Ensembl ENSG00000134551
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.