Human CDV3/H41 ORF/cDNA clone-Lentivirus plasmid (NM_017548)

Cat. No.: pGMLP005003
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CDV3/H41 Lentiviral expression plasmid for CDV3 lentivirus packaging, CDV3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CDV3/H41 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $494.25
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005003
Gene Name CDV3
Accession Number NM_017548
Gene ID 55573
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 777 bp
Gene Alias H41
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGAGACGGAGGAGCGGAGCCTGGACAACTTCTTTGCCAAGAGGGACAAGAAGAAGAAGAAGGAGCGGAGCAACCGGGCGGCGAGTGCCGCGGGCGCAGCGGGCAGCGCCGGCGGAAGCAGTGGAGCCGCGGGTGCGGCGGGCGGCGGGGCGGGCGCGGGGACCCGGCCGGGTGACGGCGGGACCGCCAGCGCGGGGGCTGCGGGCCCAGGGGCCGCCACCAAGGCTGTGACGAAGGACGAAGATGAATGGAAAGAATTGGAGCAAAAAGAGGTTGATTACAGCGGCCTCAGGGTTCAGGCAATGCAAATAAGCAGTGAAAAGGAAGAAGACGATAATGAAAAGAGACAAGATCCAGGTGATAACTGGGAAGAAGGTGGAGGTGGTGGTGGAGGTATGGAAAAATCTTCAGGTCCCTGGAATAAAACAGCTCCAGTACAAGCACCTCCTGCTCCAGTAATTGTTACAGAAACCCCAGAACCAGCGATGACTAGTGGTGTGTATAGGCCTCCTGGGGCCAGGTTAACCACAACAAGGAAAACACCACAAGGACCACCAGAAATCTACAGTGATACACAGTTCCCATCCCTGCAGTCAACTGCCAAGCATGTAGAAAGCCGGAAGGATAAAGAAATGGAGAAGAGCTTTGAAGTAGTAAGACACAAAAATAGAGGTAGGGATGAGGTTTCAAAAAACCAGGCCCTTAAACTTCAGCTAGACAACCAATATGCTGTGCTTGAAAATCAGAAAAGCAGCCACTCACAATACAATTAA
ORF Protein Sequence MAETEERSLDNFFAKRDKKKKKERSNRAASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGDGGTASAGAAGPGAATKAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDPGDNWEEGGGGGGGMEKSSGPWNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTRKTPQGPPEIYSDTQFPSLQSTAKHVESRKDKEMEKSFEVVRHKNRGRDEVSKNQALKLQLDNQYAVLENQKSSHSQYN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2048-Ab Anti-CDV3/ H41 monoclonal antibody
    Target Antigen GM-Tg-g-MP2048-Ag CDV3 VLP (virus-like particle)
    ORF Viral Vector pGMLP005003 Human CDV3 Lentivirus plasmid
    ORF Viral Vector vGMLP005003 Human CDV3 Lentivirus particle


    Target information

    Target ID GM-MP2048
    Target Name CDV3
    Gene Group Identifier
    (Target Gene ID in Homo species)
    55573
    Gene ID 100065157 (Equus caballus), 100685602 (Canis lupus familiaris), 101089890 (Felis catus), 315970 (Rattus norvegicus)
    321022 (Mus musculus), 504871 (Bos taurus), 55573 (Homo sapiens), 719067 (Macaca mulatta)
    Gene Symbols & Synonyms CDV3,Cdv3,TPP36,2510010F10Rik,C230084J24Rik,H41
    Target Alternative Names CDV3,Protein CDV3 homolog,H41
    Uniprot Accession Q4VAA2,Q5XIM5,Q9UKY7
    Additional SwissProt Accessions: Q5XIM5,Q4VAA2,Q9UKY7
    Uniprot Entry Name
    Protein Sub-location Transmembrane Protein
    Category
    Disease
    Disease from KEGG
    Gene Ensembl ENSECAG00000015689, ENSCAFG00845029806, ENSMUSG00000032803, ENSBTAG00000035556, ENSG00000091527, ENSMMUG00000000058
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.