Human ADM2/AM2/dJ579N16.4 ORF/cDNA clone-Lentivirus plasmid (NM_001253845)

Cat. No.: pGMLP004965
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human ADM2/AM2/dJ579N16.4 Lentiviral expression plasmid for ADM2 lentivirus packaging, ADM2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to ADM2/AM2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP004965
Gene Name ADM2
Accession Number NM_001253845
Gene ID 79924
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 447 bp
Gene Alias AM2,dJ579N16.4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCCGGATCCCGACGGCCGCCCTGGGTTGCATCAGCCTCCTCTGCCTGCAGCTCCCTGGCTCGCTGTCCCGCAGCCTGGGCGGGGACCCGCGACCCGTCAAACCCAGGGAGCCCCCAGCCCGGAGCCCTTCCAGCAGCCTGCAGCCCAGGCACCCCGCACCCCGACCTGTGGTCTGGAAGCTTCACCGGGCCCTCCAGGCACAGAGGGGTGCCGGCCTGGCCCCTGTTATGGGTCAGCCTCTCCGGGATGGTGGCCGCCAACACTCGGGCCCCCGAAGACACTCGGGCCCCCGCAGGACCCAAGCCCAGCTCCTGCGAGTGGGCTGTGTGCTGGGCACCTGCCAGGTGCAGAATCTCAGCCACCGCCTGTGGCAACTCATGGGACCGGCCGGCCGGCAGGACTCAGCTCCTGTGGACCCCAGCAGCCCCCACAGCTATGGCTGA
ORF Protein Sequence MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVWKLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHSYG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T68208-Ab Anti-ADM2/ AM2/ dJ579N16.4 functional antibody
    Target Antigen GM-Tg-g-T68208-Ag ADM2 protein
    ORF Viral Vector pGMLP004965 Human ADM2 Lentivirus plasmid
    ORF Viral Vector vGMLP004965 Human ADM2 Lentivirus particle


    Target information

    Target ID GM-T68208
    Target Name ADM2
    Gene Group Identifier
    (Target Gene ID in Homo species)
    79924
    Gene ID 100629546 (Equus caballus), 101084977 (Felis catus), 223780 (Mus musculus), 399475 (Rattus norvegicus)
    606919 (Canis lupus familiaris), 618896 (Bos taurus), 720666 (Macaca mulatta), 79924 (Homo sapiens)
    Gene Symbols & Synonyms ADM2,Adm2,Am2,IMD,Imdn,Imd,AM2,dJ579N16.4
    Target Alternative Names ADM2,Protein ADM2,Intermedin,AM2,dJ579N16.4
    Uniprot Accession P61312,Q7TNK8,Q7Z4H4
    Additional SwissProt Accessions: Q7TNK8,P61312,Q7Z4H4
    Uniprot Entry Name
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease
    Disease from KEGG Neuroactive ligand-receptor interaction, Vascular smooth muscle contraction
    Gene Ensembl ENSMUSG00000054136, ENSCAFG00845028178, ENSMMUG00000062822, ENSG00000128165
    Target Classification


    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.